• Gene id: 79148

Gene Summary

• Gene Symbol: MMP28   Gene   UCSC   Ensembl
• Aliases: EPILYSIN, MM28, MMP-25, MMP-28, MMP25
• Gene name: matrix metallopeptidase 28
• Alternate names: matrix metalloproteinase-28, matrix metalloprotease MMP25,
• Gene location: 17q12 (58309714: 58367506)     Exons: 7     NC_000020.11
• Gene summary(Entrez): Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix for both normal physiological processes, such as embryonic development, reproduction and tissue remodeling, and disease processes, such as asthma a
• OMIM: 608417

Protein Summary

• Protein general information: Q9H239  
  • Name: Matrix metalloproteinase 28 (MMP 28) (EC 3.4.24. ) (Epilysin)
  • Length: 520  
  • Mass: 58939
  • Tissue specificity: Expressed at high levels in testes and lung. Low levels are detected in kidney, pancreas and skin. Also expressed in fetal lung, brain, skeletal muscle and kidney. Expressed selectively in keratinocytes. Widely expressed in several car
• Sequence:

  MVARVGLLLRALQLLLWGHLDAQPAERGGQELRKEAEAFLEKYGYLNEQVPKAPTSTRFSDAIRAFQWVSQLPVS
  GVLDRATLRQMTRPRCGVTDTNSYAAWAERISDLFARHRTKMRRKKRFAKQGNKWYKQHLSYRLVNWPEHLPEPA
  VRGAVRAAFQLWSNVSALEFWEAPATGPADIRLTFFQGDHNDGLGNAFDGPGGALAHAFLPRRGEAHFDQDERWS
  LSRRRGRNLFVVLAHEIGHTLGLTHSPAPRALMAPYYKRLGRDALLSWDDVLAVQSLYGKPLGGSVAVQLPGKLF
  TDFETWDSYSPQGRRPETQGPKYCHSSFDAITVDRQQQLYIFKGSHFWEVAADGNVSEPRPLQERWVGLPPNIEA
  AAVSLNDGDFYFFKGGRCWRFRGPKPVWGLPQLCRAGGLPRHPDAALFFPPLRRLILFKGARYYVLARGGLQVEP
  YYPRSLQDWGGIPEEVSGALPRPDGSIIFFRDDRYWRLDQAKLQATTSGRWATELPWMGCWHANSGSALF

• Structural information:
  • Interpro: IPR000585  IPR036375  IPR018487  IPR033739  IPR024079   IPR028735  IPR001818  IPR021190  IPR006026  IPR002477  IPR036365  
  • Prosite: PS51642 PS00142
  • CDD: cd00094 cd04278
  • STRING: ENSP00000473853
• Other Databases: GeneCards:  MMP28  Malacards:  MMP28

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0004222	metalloendopeptidase activity	IBA	molecular function
GO:0030198	extracellular matrix organization	IBA	biological process
GO:0030574	collagen catabolic process	IBA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0031012	extracellular matrix	IEA	cellular component
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010760	negative regulation of macrophage chemotaxis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0004222	metalloendopeptidase activity	TAS	molecular function
GO:0004222	metalloendopeptidase activity	TAS	molecular function
GO:0031012	extracellular matrix	NAS	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq