• Gene id: 79144

Gene Summary

• Gene Symbol: PPDPF   Gene   UCSC   Ensembl
• Aliases: C20orf149, dJ697K14.9, exdpf
• Gene name: pancreatic progenitor cell differentiation and proliferation factor
• Alternate names: pancreatic progenitor cell differentiation and proliferation factor, exocrine differentiation and proliferation factor, pancreatic progenitor cell differentiation and proliferation factor homolog,
• Gene location: 20q13.33 (63520740: 63522205)     Exons: 4     NC_000020.11

Protein Summary

• Protein general information: Q9H3Y8  
  • Name: Pancreatic progenitor cell differentiation and proliferation factor (Exocrine differentiation and proliferation factor)
  • Length: 114  
  • Mass: 11777
• Sequence:

  MAAIPSSGSLVATHDYYRRRLGSTSSNSSCSSTECPGEAIPHPPGLPKADPGHWWASFFFGKSTLPFMATVLESA
  EHSEPPQASSSMTACGLARDAPRKQPGGQSSTASAGPPS

• Structural information:
  • Interpro: IPR026754  
  • STRING: ENSP00000359198
• Other Databases: GeneCards:  PPDPF  Malacards:  PPDPF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030154	cell differentiation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881