• Gene id: 79135

Gene Summary

• Gene Symbol: APOO   Gene   UCSC   Ensembl
• Aliases: FAM121B, MIC26, MICOS26, Mic23, My025
• Gene name: apolipoprotein O
• Alternate names: MICOS complex subunit MIC26, MICOS complex subunit MIC23, brain my025, family with sequence similarity 121B, mitochondrial contact site and cristae organizing system subunit 26,
• Gene location: Xp22.11 (23907937: 23833347)     Exons: 11     NC_000023.11
• Gene summary(Entrez): This gene is a member of the apolipoprotein family. Members of this protein family are involved in the transport and metabolism of lipids. The encoded protein associates with HDL, LDL and VLDL lipoproteins and is characterized by chondroitin-sulfate glyco
• OMIM: 300753

Protein Summary

• Protein general information: Q9BUR5  
  • Name: MICOS complex subunit MIC26 (Apolipoprotein O) (MICOS complex subunit MIC23) (Protein FAM121B)
  • Length: 198  
  • Mass: 22285
  • Tissue specificity: Expressed in all tissues examined. Up-regulated in diabetic heart. {ECO
• Sequence:

  MFKVIQRSVGPASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQLEESISQLRHYCEPYT
  TWCQETYSQTKPKMQSLVQWGLDSYDYLQNAPPGFFPRLGVIGFAGLIGLLLARGSKIKKLVYPPGFMGLAASLY
  YPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK

• Structural information:
  • Interpro: IPR019166  IPR033182  
  • STRING: ENSP00000368528
• Other Databases: GeneCards:  APOO  Malacards:  APOO

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061617	MICOS complex	IBA	cellular component
GO:0042407	cristae formation	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0061617	MICOS complex	IDA	cellular component
GO:0061617	MICOS complex	IDA	cellular component
GO:0061617	MICOS complex	IDA	cellular component
GO:0005576	extracellular region	IDA	cellular component
GO:0000139	Golgi membrane	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0031305	integral component of mitochondrial inner membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042407	cristae formation	IMP	biological process
GO:0061617	MICOS complex	IEA	cellular component
GO:0042407	cristae formation	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0034362	low-density lipoprotein particle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0034361	very-low-density lipoprotein particle	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006869	lipid transport	IEA	biological process
GO:0034364	high-density lipoprotein particle	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005615	extracellular space	ISS	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0007007	inner mitochondrial membrane organization	IC	biological process
GO:0005739	mitochondrion	HDA	cellular component
GO:0061617	MICOS complex	HDA	cellular component
GO:0140275	MIB complex	HDA	cellular component
GO:0001401	SAM complex	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)