• Gene id: 79132

Gene Summary

• Gene Symbol: DHX58   Gene   UCSC   Ensembl
• Aliases: D11LGP2, D11lgp2e, LGP2, RLR-3
• Gene name: DExH-box helicase 58
• Alternate names: probable ATP-dependent RNA helicase DHX58, DEXH (Asp-Glu-X-His) box polypeptide 58, RIG-I-like receptor 3, RIG-I-like receptor LGP2, RLR, RNA helicase LGP2, ortholog of mouse D11lgp2, probable ATP-dependent helicase LGP2, protein D11Lgp2 homolog,
• Gene location: 17q21.2 (42112720: 42101403)     Exons: 14     NC_000017.11
• OMIM: 608588

Protein Summary

• Protein general information: Q96C10  
  • Name: Probable ATP dependent RNA helicase DHX58 (EC 3.6.4.13) (Probable ATP dependent helicase LGP2) (Protein D11Lgp2 homolog) (RIG I like receptor 3) (RLR 3) (RIG I like receptor LGP2) (RLR)
  • Length: 678  
  • Mass: 76613
• Sequence:

  MELRSYQWEVIMPALEGKNIIIWLPTGAGKTRAAAYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGRW
  TVTTLSGDMGPRAGFGHLARCHDLLICTAELLQMALTSPEEEEHVELTVFSLIVVDECHHTHKDTVYNVIMSQYL
  ELKLQRAQPLPQVLGLTASPGTGGASKLDGAINHVLQLCANLDTWCIMSPQNCCPQLQEHSQQPCKQYNLCHRRS
  QDPFGDLLKKLMDQIHDHLEMPELSRKFGTQMYEQQVVKLSEAAALAGLQEQRVYALHLRRYNDALLIHDTVRAV
  DALAALQDFYHREHVTKTQILCAERRLLALFDDRKNELAHLATHGPENPKLEMLEKILQRQFSSSNSPRGIIFTR
  TRQSAHSLLLWLQQQQGLQTVDIRAQLLIGAGNSSQSTHMTQRDQQEVIQKFQDGTLNLLVATSVAEEGLDIPHC
  NVVVRYGLLTNEISMVQARGRARADQSVYAFVATEGSRELKRELINEALETLMEQAVAAVQKMDQAEYQAKIRDL
  QQAALTKRAAQAAQRENQRQQFPVEHVQLLCINCMVAVGHGSDLRKVEGTHHVNVNPNFSNYYNVSRDPVVINKV
  FKDWKPGGVISCRNCGEVWGLQMIYKSVKLPVLKVRSMLLETPQGRIQAKKWSRVPFSVPDFDFLQHCAENLSDL
  SLD

• Structural information:
  • Protein Domains: (11..18-)
    (/note="Helicase-ATP-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00541-)
    (350..51-)
    (/note="Helicase-C-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00542-)
    (539..66-)
    (/note="RLR-CTR)
    (/evidence="ECO:0000255|-)
  • Interpro: IPR006935  IPR014001  IPR001650  IPR027417  IPR041204   IPR038557  IPR021673  
  • Prosite: PS51192 PS51194 PS51789
  • PDB: 2RQA 2W4R 3EQT
  • PDBsum: 2RQA 2W4R 3EQT
  • DIP: 60792
  • STRING: ENSP00000251642
• Other Databases: GeneCards:  DHX58  Malacards:  DHX58

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008270	zinc ion binding	IBA	molecular function
GO:0009615	response to virus	IBA	biological process
GO:0045087	innate immune response	IBA	biological process
GO:0003725	double-stranded RNA binding	IBA	molecular function
GO:0003727	single-stranded RNA binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0032728	positive regulation of interferon-beta production	IBA	biological process
GO:2000778	positive regulation of interleukin-6 secretion	IBA	biological process
GO:0045824	negative regulation of innate immune response	IDA	biological process
GO:0008270	zinc ion binding	IDA	molecular function
GO:0045088	regulation of innate immune response	IDA	biological process
GO:0039536	negative regulation of RIG-I signaling pathway	IDA	biological process
GO:0032480	negative regulation of type I interferon production	IDA	biological process
GO:0003727	single-stranded RNA binding	IDA	molecular function
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:1900245	positive regulation of MDA-5 signaling pathway	ISS	biological process
GO:0009615	response to virus	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1900246	positive regulation of RIG-I signaling pathway	ISS	biological process
GO:0039536	negative regulation of RIG-I signaling pathway	IMP	biological process
GO:0039534	negative regulation of MDA-5 signaling pathway	IMP	biological process
GO:0032481	positive regulation of type I interferon production	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0004386	helicase activity	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0003724	RNA helicase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1900245	positive regulation of MDA-5 signaling pathway	IEA	biological process
GO:0045824	negative regulation of innate immune response	IEA	biological process
GO:0009617	response to bacterium	IEA	biological process
GO:0009615	response to virus	IEA	biological process
GO:1900246	positive regulation of RIG-I signaling pathway	IEA	biological process
GO:0039536	negative regulation of RIG-I signaling pathway	IEA	biological process
GO:0032481	positive regulation of type I interferon production	IEA	biological process
GO:0032480	negative regulation of type I interferon production	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003725	double-stranded RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04622	RIG-I-like receptor signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq