• Gene id: 7913

Gene Summary

• Gene Symbol: DEK   Gene   UCSC   Ensembl
• Aliases: D6S231E
• Gene name: DEK proto-oncogene
• Alternate names: protein DEK, DEK oncogene (DNA binding),
• Gene location: 6p22.3 (18264540: 18223859)     Exons: 13     NC_000006.12
• Gene summary(Entrez): This gene encodes a protein with one SAP domain. This protein binds to cruciform and superhelical DNA and induces positive supercoils into closed circular DNA, and is also involved in splice site selection during mRNA processing. Chromosomal aberrations i
• OMIM: 125264

Protein Summary

• Protein general information: P35659  
  • Name: Protein DEK
  • Length: 375  
  • Mass: 42674
  • Tissue specificity: Ubiquitous. Expressed at relatively high levels.
• Sequence:

  MSASAPAAEGEGTPTQPASEKEPEMPGPREESEEEEDEDDEEEEEEEKEKSLIVEGKREKKKVERLTMQVSSLQR
  EPFTIAQGKGQKLCEIERIHFFLSKKKTDELRNLHKLLYNRPGTVSSLKKNVGQFSGFPFEKGSVQYKKKEEMLK
  KFRNAMLKSICEVLDLERSGVNSELVKRILNFLMHPKPSGKPLPKSKKTCSKGSKKERNSSGMARKAKRTKCPEI
  LSDESSSDEDEKKNKEESSDDEDKESEEEPPKKTAKREKPKQKATSKSKKSVKSANVKKADSSTTKKNQNSSKKE
  SESEDSSDDEPLIKKLKKPPTDEELKETIKKLLASANLEEVTMKQICKKVYENYPTYDLTERKDFIKTTVKELIS

• Structural information:
  • Protein Domains: (149..18-)
    (/note="SAP"-)
  • Interpro: IPR014876  IPR003034  IPR036361  
  • PDB: 1Q1V 2JX3
  • PDBsum: 1Q1V 2JX3
  • STRING: ENSP00000380414
• Other Databases: GeneCards:  DEK  Malacards:  DEK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:2000779	regulation of double-strand break repair	IBA	biological process
GO:0042393	histone binding	IBA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0019079	viral genome replication	TAS	biological process
GO:0006357	regulation of transcription by RNA polymerase II	TAS	biological process
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005634	nucleus	IDA	cellular component
GO:2000779	regulation of double-strand break repair	IMP	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	TAS	biological process
GO:0045815	positive regulation of gene expression, epigenetic	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:2001032	regulation of double-strand break repair via nonhomologous end joining	IEA	biological process
GO:0043292	contractile fiber	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0042393	histone binding	IDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881