• Gene id: 79109

Gene Summary

• Gene Symbol: MAPKAP1   Gene   UCSC   Ensembl
• Aliases: JC310, MIP1, SIN1, SIN1b, SIN1g
• Gene name: MAPK associated protein 1
• Alternate names: target of rapamycin complex 2 subunit MAPKAP1, MEKK2-interacting protein 1, SAPK-interacting protein 1, TORC2 subunit MAPKAP1, mSIN1, mitogen-activated protein kinase 2-associated protein 1, mitogen-activated protein kinase associated protein 1, ras inhibitor MG,
• Gene location: 9q33.3 (125707233: 125437393)     Exons: 1     NC_000009.12
• Gene summary(Entrez): This gene encodes a protein that is highly similar to the yeast SIN1 protein, a stress-activated protein kinase. Alternatively spliced transcript variants encoding distinct isoforms have been described. Alternate polyadenylation sites as well as alternate
• OMIM: 610558

Protein Summary

• Protein general information: Q9BPZ7  
  • Name: Target of rapamycin complex 2 subunit MAPKAP1 (TORC2 subunit MAPKAP1) (Mitogen activated protein kinase 2 associated protein 1) (Stress activated map kinase interacting protein 1) (SAPK interacting protein 1) (mSIN1)
  • Length: 522  
  • Mass: 59123
  • Tissue specificity: Ubiquitously expressed, with highest levels in heart and skeletal muscle. {ECO
• Sequence:

  MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKIHPPSMPGDSGSEIQGSNGETQGYVYAQSVDITSS
  WDFGIRRRSNTAQRLERLRKERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPISGKQSILSVRLEQCP
  LQLNNPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTMASARVQDLIGLICWQYTSEGREPKLND
  NVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLFVRINAAHGFSLIQVDNTKVT
  MKEILLKAVKRRKGSQKVSGPQYRLEKQSEPNVAVDLDSTLESQSAWEFCLVRENSSRADGVFEEDSQIDIATVQ
  DMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDSDLLCACDLAEEKSPSH
  AIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRASTARADYFAQKQRKLNRRTSFSFQKEKKSGQQ

• Structural information:
  • Interpro: IPR031567  IPR011993  IPR032679  IPR031313  
  • PDB: 3VOQ 5ZCS
  • PDBsum: 3VOQ 5ZCS
  • DIP: 39480
  • STRING: ENSP00000265960
• Other Databases: GeneCards:  MAPKAP1  Malacards:  MAPKAP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019901	protein kinase binding	IPI	molecular function
GO:0038203	TORC2 signaling	IBA	biological process
GO:0031932	TORC2 complex	IBA	cellular component
GO:0030950	establishment or maintenance of actin cytoskeleton polarity	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	IBA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0032148	activation of protein kinase B activity	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031932	TORC2 complex	IEA	cellular component
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IEA	biological process
GO:1900407	regulation of cellular response to oxidative stress	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0080025	phosphatidylinositol-3,5-bisphosphate binding	IDA	molecular function
GO:0070300	phosphatidic acid binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0017016	Ras GTPase binding	IDA	molecular function
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0021762	substantia nigra development	HEP	biological process
GO:0043325	phosphatidylinositol-3,4-bisphosphate binding	IDA	molecular function
GO:0005547	phosphatidylinositol-3,4,5-trisphosphate binding	IDA	molecular function
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	IDA	molecular function
GO:0046580	negative regulation of Ras protein signal transduction	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04150	mTOR signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq