• Gene id: 79102

Gene Summary

• Gene Symbol: RNF26   Gene   UCSC   Ensembl
• Gene name: ring finger protein 26
• Alternate names: E3 ubiquitin-protein ligase RNF26, ring finger protein with leucine zipper,
• Gene location: 11q23.3 (168497038: 168928440)     Exons: 29     NC_000004.12
• Gene summary(Entrez): The protein encoded by this intronless gene contains a C3HC5 type of RING finger, a motif known to be involved in protein-DNA and protein-protein interactions. The expression of this gene was found to be upregulated in cancer cell lines derived from diffe
• OMIM: 606130

Protein Summary

• Protein general information: Q9BY78  
  • Name: E3 ubiquitin protein ligase RNF26 (EC 2.3.2.27) (RING finger protein 26)
  • Length: 433  
  • Mass: 47737
  • Tissue specificity: Ubiquitous. Up-regulated in several cancer cell lines. {ECO
• Sequence:

  MEAVYLVVNGLGLVLDVLTLVLDLNFLLVSSLLASLAWLLAFVYNLPHTVLTSLLHLGRGVLLSLLALIEAVVRF
  TCGGLQALCTLLYSCCSGLESLKLLGHLASHGALRSREILHRGVLNVVSSGHALLRQACDICAIAMSLVAYVINS
  LVNICLIGTQNLFSLVLALWDAVTGPLWRMTDVVAAFLAHISSSAVAMAILLWTPCQLALELLASAARLLASFVL
  VNLTGLVLLACVLAVTVTVLHPDFTLRLATQALSQLHARPSYHRLREDVMRLSRLALGSEAWRRVWSRSLQLASW
  PNRGGAPGAPQGDPMRVFSVRTRRQDTLPEAGRRSEAEEEEARTIRVTPVRGRERLNEEEPPGGQDPWKLLKEQE
  ERKKCVICQDQSKTVLLLPCRHLCLCQACTEILMRHPVYHRNCPLCRRGILQTLNVYL

• Structural information:
  • Interpro: IPR040089  IPR001841  IPR013083  
  • Prosite: PS50089
  • CDD: cd16788
  • STRING: ENSP00000312439
• Other Databases: GeneCards:  RNF26  Malacards:  RNF26

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050687	negative regulation of defense response to virus	IDA	biological process
GO:0032479	regulation of type I interferon production	IDA	biological process
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0070979	protein K11-linked ubiquitination	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0007032	endosome organization	IDA	biological process
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0016567	protein ubiquitination	IDA	biological process
GO:1905719	protein localization to perinuclear region of cytoplasm	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0008270	zinc ion binding	NAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq