• Gene id: 79101

Gene Summary

• Gene Symbol: TAF1D   Gene   UCSC   Ensembl
• Aliases: JOSD3, RAFI41, TAF(I)41, TAFI41
• Gene name: TATA-box binding protein associated factor, RNA polymerase I subunit D
• Alternate names: TATA box-binding protein-associated factor RNA polymerase I subunit D, Josephin domain containing 3, RNA polymerase I-specific TBP-associated factor 41 kDa, TATA box binding protein (TBP)-associated factor, RNA polymerase I, D, 41kDa, TATA box-binding protein,
• Gene location: 11q21 (93741536: 93730193)     Exons: 14     NC_000011.10
• Gene summary(Entrez): TAF1D is a member of the SL1 complex, which includes TBP (MIM 600075) and TAF1A (MIM 604903), TAF1B (MIM 604904), and TAF1C (MIM 604905), and plays a role in RNA polymerase I transcription (Wang et al., 2004 [PubMed 15520167]; Gorski et al., 2007 [PubMed
• OMIM: 607372

Protein Summary

• Protein general information: Q9H5J8  
  • Name: TATA box binding protein associated factor RNA polymerase I subunit D (RNA polymerase I specific TBP associated factor 41 kDa) (TAFI41) (TATA box binding protein associated factor 1D) (TBP associated factor 1D) (Transcription initiation factor SL1/TIF IB
  • Length: 278  
  • Mass: 32058
• Sequence:

  MDKSGIDSLDHVTSDAVELANRSDNSSDSSLFKTQCIPYSPKGEKRNPIRKFVRTPESVHASDSSSDSSFEPIPL
  TIKAIFERFKNRKKRYKKKKKRRYQPTGRPRGRPEGRRNPIYSLIDKKKQFRSRGSGFPFLESENEKNAPWRKIL
  TFEQAVARGFFNYIEKLKYEHHLKESLKQMNVGEDLENEDFDSRRYKFLDDDGSISPIEESTAEDEDATHLEDNE
  CDIKLAGDSFIVSSEFPVRLSVYLEEEDITEEAALSKKRATKAKNTGQRGLKM

• Structural information:
  • Interpro: IPR027976  
  • STRING: ENSP00000410409
• Other Databases: GeneCards:  TAF1D  Malacards:  TAF1D

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005654	nucleoplasm	IBA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005668	RNA polymerase transcription factor SL1 complex	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006361	transcription initiation from RNA polymerase I promoter	TAS	biological process
GO:0006361	transcription initiation from RNA polymerase I promoter	TAS	biological process
GO:0006362	transcription elongation from RNA polymerase I promoter	TAS	biological process
GO:0006363	termination of RNA polymerase I transcription	TAS	biological process
GO:0045815	positive regulation of gene expression, epigenetic	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0072686	mitotic spindle	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0034451	centriolar satellite	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881