• Gene id: 79091

Gene Summary

• Gene Symbol: METTL22   Gene   UCSC   Ensembl
• Aliases: C16orf68
• Gene name: methyltransferase like 22
• Alternate names: methyltransferase-like protein 22, LP8272,
• Gene location: 16p13.2 (8621669: 8673564)     Exons: 18     NC_000016.10
• Gene summary(Entrez): This gene encodes a member of the non-histone lysine methyltransferases. It interacts with its substrate, Kin17, which is involved in DNA repair and replication and mRNA processing. Alternative splicing results in multiple transcript variants. [provided b
• OMIM: 615261

Protein Summary

• Protein general information: Q9BUU2  
  • Name: Methyltransferase like protein 22 (EC 2.1.1. )
  • Length: 404  
  • Mass: 44486
• Sequence:

  MVQLAPAAAMDEVTFRSDTVLSDVHLYTPNHRHLMVRLNSVGQPVFLSQFKLLWSQDSWTDSGAKGGSHRDVHTK
  EPPSAETGSTGSPPGSGHGNEGFSLQAGTDTTGQEVAEAQLDEDGDLDVVRRPRAASDSNPAGPLRDKVHPMILA
  QEEDDVLGEEAQGSPHDIIRIEHTMATPLEDVGKQVWRGALLLADYILFRQDLFRGCTALELGAGTGLASIIAAT
  MARTVYCTDVGADLLSMCQRNIALNSHLAATGGGIVRVKELDWLKDDLCTDPKVPFSWSQEEISDLYDHTTILFA
  AEVFYDDDLTDAVFKTLSRLAHRLKNACTAILSVEKRLNFTLRHLDVTCEAYDHFRSCLHALEQLADGKLRFVVE
  PVEASFPQLLVYERLQQLELWKIIAEPVT

• Structural information:
  • Interpro: IPR019410  IPR038899  IPR029063  
  • STRING: ENSP00000371345
• Other Databases: GeneCards:  METTL22  Malacards:  METTL22

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008276	protein methyltransferase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0006479	protein methylation	IEA	biological process
GO:0008276	protein methyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0032259	methylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006479	protein methylation	TAS	biological process
GO:0016279	protein-lysine N-methyltransferase activity	TAS	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0018022	peptidyl-lysine methylation	IEA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0008276	protein methyltransferase activity	IDA	molecular function
GO:0006479	protein methylation	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray