• Gene id: 79089

Gene Summary

• Gene Symbol: TMUB2   Gene   UCSC   Ensembl
• Aliases: FP2653
• Gene name: transmembrane and ubiquitin like domain containing 2
• Alternate names: transmembrane and ubiquitin-like domain-containing protein 2,
• Gene location: 17q21.31 (44186950: 44191928)     Exons: 6     NC_000017.11

Protein Summary

• Protein general information: Q71RG4  
  • Name: Transmembrane and ubiquitin like domain containing protein 2
  • Length: 321  
  • Mass: 33788
• Sequence:

  MISRHLQNNLMSVDPASSQAMELSDVTLIEGVGNEVMVVAGVVVLILALVLAWLSTYVADSGSNQLLGAIVSAGD
  TSVLHLGHVDHLVAGQGNPEPTELPHPSEGNDEKAEEAGEGRGDSTGEAGAGGGVEPSLEHLLDIQGLPKRQAGA
  GSSSPEAPLRSEDSTCLPPSPGLITVRLKFLNDTEELAVARPEDTVGALKSKYFPGQESQMKLIYQGRLLQDPAR
  TLRSLNITDNCVIHCHRSPPGSAVPGPSASLAPSATEPPSLGVNVGSLMVPVFVVLLGVVWYFRINYRQFFTAPA
  TVSLVGVTVFFSFLVFGMYGR

• Structural information:
  • Protein Domains: (174..24-)
    (/note="Ubiquitin-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00214"-)
  • Interpro: IPR040352  IPR000626  IPR029071  
  • Prosite: PS50053
  • DIP: 60896
  • STRING: ENSP00000466971
• Other Databases: GeneCards:  TMUB2  Malacards:  TMUB2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030433	ubiquitin-dependent ERAD pathway	IBA	biological process
GO:0030433	ubiquitin-dependent ERAD pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881