• Gene id: 79084

Gene Summary

• Gene Symbol: WDR77   Gene   UCSC   Ensembl
• Aliases: HKMT1069, MEP-50, MEP50, Nbla10071, p44, p44/Mep50
• Gene name: WD repeat domain 77
• Alternate names: methylosome protein 50, WD repeat-containing protein 77, androgen receptor cofactor p44, testis tissue sperm-binding protein Li 44a,
• Gene location: 1p13.2 (111449307: 111439889)     Exons: 10     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is an androgen receptor coactivator that forms a complex with protein arginine methyltransferase 5, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins. The encoded protein may be inv
• OMIM: 611734

Protein Summary

• Protein general information: Q9BQA1  
  • Name: Methylosome protein 50 (MEP 50) (Androgen receptor cofactor p44) (WD repeat containing protein 77) (p44/Mep50)
  • Length: 342  
  • Mass: 36724
  • Tissue specificity: Highly expressed in heart, skeletal muscle, spleen, testis, uterus, prostate and thymus. In testis, expressed in germ cells and Leydig cells, but not in peritubular myocytes, nor in Sertoli cells. Expressed in prostate cancers, in semi
• Sequence:

  MRKETPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNEGFCSA
  GVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIK
  VWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQS
  EVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFV
  RDATWSPLNHSLLTTVGWDHQVVHHVVPTEPLPAPGPASVTE

• Structural information:
  • Interpro: IPR015943  IPR001680  IPR019775  IPR017986  IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • PDB: 4GQB 4X60 4X61 4X63 5C9Z 5EMJ 5EMK 5EML 5EMM 5FA5 6CKC 6K1S
  • PDBsum: 4GQB 4X60 4X61 4X63 5C9Z 5EMJ 5EMK 5EML 5EMM 5FA5 6CKC 6K1S
  • DIP: 38172
  • STRING: ENSP00000235090
• Other Databases: GeneCards:  WDR77  Malacards:  WDR77

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005654	nucleoplasm	IBA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0008284	positive regulation of cell population proliferation	IBA	biological process
GO:0060770	negative regulation of epithelial cell proliferation involved in prostate gland development	IBA	biological process
GO:0007315	pole plasm assembly	IBA	biological process
GO:0008327	methyl-CpG binding	IBA	molecular function
GO:0030374	nuclear receptor transcription coactivator activity	IBA	molecular function
GO:0034709	methylosome	IBA	cellular component
GO:0045495	pole plasm	IBA	cellular component
GO:0060528	secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development	IBA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0034709	methylosome	IDA	cellular component
GO:0008327	methyl-CpG binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0034709	methylosome	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0030374	nuclear receptor transcription coactivator activity	IGI	molecular function
GO:0005737	cytoplasm	IGI	cellular component
GO:0005634	nucleus	IGI	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000387	spliceosomal snRNP assembly	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060770	negative regulation of epithelial cell proliferation involved in prostate gland development	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0060528	secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)