• Gene id: 79077

Gene Summary

• Gene Symbol: DCTPP1   Gene   UCSC   Ensembl
• Aliases: CDA03, RS21C6, XTP3TPA
• Gene name: dCTP pyrophosphatase 1
• Alternate names: dCTP pyrophosphatase 1, XTP3-transactivated gene A protein, XTP3-transactivated protein A, dCTPase 1, deoxycytidine-triphosphatase 1,
• Gene location: 16p11.2 (30430029: 30423614)     Exons: 4     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene is dCTP pyrophosphatase, which converts dCTP to dCMP and inorganic pyrophosphate. The encoded protein also displays weak activity against dTTP and dATP, but none against dGTP. This protein may be responsible for eliminatin
• OMIM: 615840

Protein Summary

• Protein general information: Q9H773  
  • Name: dCTP pyrophosphatase 1 (EC 3.6.1.12) (Deoxycytidine triphosphatase 1) (dCTPase 1) (RS21C6) (XTP3 transactivated gene A protein)
  • Length: 170  
  • Mass: 18681
• Sequence:

  MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKT
  DGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRKYTELPHGAIS
  EDQAVGPADIPCDSTGQTST

• Structural information:
  • Interpro: IPR025984  
  • CDD: cd11537
  • STRING: ENSP00000322524
• Other Databases: GeneCards:  DCTPP1  Malacards:  DCTPP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0047429	nucleoside-triphosphate diphosphatase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0047840	dCTP diphosphatase activity	IBA	molecular function
GO:0042262	DNA protection	IBA	biological process
GO:0009143	nucleoside triphosphate catabolic process	IBA	biological process
GO:0006253	dCTP catabolic process	IBA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0047429	nucleoside-triphosphate diphosphatase activity	IDA	molecular function
GO:0047840	dCTP diphosphatase activity	IDA	molecular function
GO:0009143	nucleoside triphosphate catabolic process	IDA	biological process
GO:0046076	dTTP catabolic process	IMP	NOT|biological process
GO:0042262	DNA protection	IMP	biological process
GO:0006253	dCTP catabolic process	IMP	biological process
GO:0047429	nucleoside-triphosphate diphosphatase activity	ISS	molecular function
GO:0005829	cytosol	ISS	cellular component
GO:0000287	magnesium ion binding	ISS	molecular function
GO:0009143	nucleoside triphosphate catabolic process	ISS	biological process
GO:0047429	nucleoside-triphosphate diphosphatase activity	IEA	molecular function
GO:0009143	nucleoside triphosphate catabolic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0047840	dCTP diphosphatase activity	IEA	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0032556	pyrimidine deoxyribonucleotide binding	IEA	molecular function
GO:0047429	nucleoside-triphosphate diphosphatase activity	IEA	molecular function
GO:0009143	nucleoside triphosphate catabolic process	IEA	biological process
GO:0016462	pyrophosphatase activity	IEA	molecular function
GO:0042802	identical protein binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00240	Pyrimidine metabolism

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)