• Gene id: 79073

Gene Summary

• Gene Symbol: TMEM109   Gene   UCSC   Ensembl
• Gene name: transmembrane protein 109
• Alternate names: transmembrane protein 109, mg23, mitsugumin-23,
• Gene location: 11q12.2 (60914157: 60923442)     Exons: 4     NC_000011.10
• OMIM: 608746

Protein Summary

• Protein general information: Q9BVC6  
  • Name: Transmembrane protein 109 (Mitsugumin 23) (Mg23)
  • Length: 243  
  • Mass: 26210
• Sequence:

  MAASSISSPWGKHVFKAILMVLVALILLHSALAQSRRDFAPPGQQKREAPVDVLTQIGRSVRGTLDAWIGPETMH
  LVSESSSQVLWAISSAISVAFFALSGIAAQLLNALGLAGDYLAQGLKLSPGQVQTFLLWGAGALVVYWLLSLLLG
  LVLALLGRILWGLKLVIFLAGFVALMRSVPDPSTRALLLLALLILYALLSRLTGSRASGAQLEAKVRGLERQVEE
  LRWRQRRAAKGARSVEEE

• Structural information:
  • Interpro: IPR039492  
  • STRING: ENSP00000227525
• Other Databases: GeneCards:  TMEM109  Malacards:  TMEM109

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071480	cellular response to gamma radiation	IBA	biological process
GO:0060548	negative regulation of cell death	IBA	biological process
GO:0042771	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IBA	biological process
GO:0060548	negative regulation of cell death	IEA	biological process
GO:0071480	cellular response to gamma radiation	IEA	biological process
GO:0016529	sarcoplasmic reticulum	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0071480	cellular response to gamma radiation	IMP	biological process
GO:0060548	negative regulation of cell death	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042771	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0033017	sarcoplasmic reticulum membrane	IEA	cellular component
GO:0005640	nuclear outer membrane	IEA	cellular component
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq