• Gene id: 79066

Gene Summary

• Gene Symbol: METTL16   Gene   UCSC   Ensembl
• Aliases: METT10D
• Gene name: methyltransferase like 16
• Alternate names: RNA N6-adenosine-methyltransferase METTL16, N6-adenosine-methyltransferase METTL16, U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase, U6 snRNA methyltransferase, methyltransferase 10 domain containing, methyltransferase 10 domain-containing protein, m,
• Gene location: 17p13.3 (2511900: 2416048)     Exons: 11     NC_000017.11
• OMIM: 606048

Protein Summary

• Protein general information: Q86W50  
  • Name: RNA N6 adenosine methyltransferase METTL16 (Methyltransferase 10 domain containing protein) (Methyltransferase like protein 16) (N6 adenosine methyltransferase METTL16) (EC 2.1.1.348) (U6 small nuclear RNA (adenine (43) N(6)) methyltransferase) (EC 2.1.1.
  • Length: 562  
  • Mass: 63621
• Sequence:

  MALSKSMHARNRYKDKPPDFAYLASKYPDFKQHVQINLNGRVSLNFKDPEAVRALTCTLLREDFGLSIDIPLERL
  IPTVPLRLNYIHWVEDLIGHQDSDKSTLRRGIDIGTGASCIYPLLGATLNGWYFLATEVDDMCFNYAKKNVEQNN
  LSDLIKVVKVPQKTLLMDALKEESEIIYDFCMCNPPFFANQLEAKGVNSRNPRRPPPSSVNTGGITEIMAEGGEL
  EFVKRIIHDSLQLKKRLRWYSCMLGKKCSLAPLKEELRIQGVPKVTYTEFCQGRTMRWALAWSFYDDVTVPSPPS
  KRRKLEKPRKPITFVVLASVMKELSLKASPLRSETAEGIVVVTTWIEKILTDLKVQHKRVPCGKEEVSLFLTAIE
  NSWIHLRRKKRERVRQLREVPRAPEDVIQALEEKKPTPKESGNSQELARGPQERTPCGPALREGEAAAVEGPCPS
  QESLSQEENPEPTEDERSEEKGGVEVLESCQGSSNGAQDQEASEQFGSPVAERGKRLPGVAGQYLFKCLINVKKE
  VDDALVEMHWVEGQNRDLMNQLCTYIRNQIFRLVAVN

• Structural information:
  • Interpro: IPR017182  IPR010286  IPR029063  
  • PDB: 2H00 6B91 6B92 6DU4 6DU5 6GFK 6GFN 6GT5
  • PDBsum: 2H00 6B91 6B92 6DU4 6DU5 6GFK 6GFN 6GT5
  • STRING: ENSP00000263092
• Other Databases: GeneCards:  METTL16  Malacards:  METTL16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0052907	23S rRNA (adenine(1618)-N(6))-methyltransferase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0070475	rRNA base methylation	IBA	biological process
GO:0001734	mRNA (N6-adenosine)-methyltransferase activity	IDA	molecular function
GO:0048024	regulation of mRNA splicing, via spliceosome	IDA	biological process
GO:0035613	RNA stem-loop binding	IDA	molecular function
GO:0120049	snRNA (adenine-N6)-methylation	IDA	biological process
GO:0120049	snRNA (adenine-N6)-methylation	IDA	biological process
GO:0001734	mRNA (N6-adenosine)-methyltransferase activity	IDA	molecular function
GO:0001734	mRNA (N6-adenosine)-methyltransferase activity	IDA	molecular function
GO:0003723	RNA binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0120048	U6 snRNA (adenine-(43)-N(6))-methyltransferase activity	IDA	molecular function
GO:0030629	U6 snRNA 3'-end binding	IDA	molecular function
GO:0010608	posttranscriptional regulation of gene expression	IDA	biological process
GO:1905869	negative regulation of 3'-UTR-mediated mRNA stabilization	IDA	biological process
GO:0030629	U6 snRNA 3'-end binding	IDA	molecular function
GO:0120048	U6 snRNA (adenine-(43)-N(6))-methyltransferase activity	IDA	molecular function
GO:0006556	S-adenosylmethionine biosynthetic process	IDA	biological process
GO:0006556	S-adenosylmethionine biosynthetic process	IDA	biological process
GO:0080009	mRNA methylation	IDA	biological process
GO:0080009	mRNA methylation	IDA	biological process
GO:0061157	mRNA destabilization	ISS	biological process
GO:0006402	mRNA catabolic process	ISS	biological process
GO:0006556	S-adenosylmethionine biosynthetic process	IMP	biological process
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0032259	methylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0001734	mRNA (N6-adenosine)-methyltransferase activity	IEA	molecular function
GO:0001510	RNA methylation	IEA	biological process
GO:0080009	mRNA methylation	IEA	biological process
GO:0061157	mRNA destabilization	IEA	biological process
GO:0010608	posttranscriptional regulation of gene expression	IEA	biological process
GO:0006556	S-adenosylmethionine biosynthetic process	IEA	biological process
GO:0006402	mRNA catabolic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq