Search Result
Gene id | 79056 | ||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||
Gene Symbol | PRRG4 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||
Aliases | PRGP4, TMG4 | ||||||||||||||||||||||||||||||||||||
Gene name | proline rich and Gla domain 4 | ||||||||||||||||||||||||||||||||||||
Alternate names | transmembrane gamma-carboxyglutamic acid protein 4, proline rich Gla (G-carboxyglutamic acid) 4 (transmembrane), proline rich Gla 4 (transmembrane) isoform 1, proline rich Gla 4 (transmembrane) isoform 2, proline rich Gla 4 (transmembrane) isoform 3, proline-r, | ||||||||||||||||||||||||||||||||||||
Gene location |
11p13 (32829755: 32858119) Exons: 6 NC_000011.10 |
||||||||||||||||||||||||||||||||||||
OMIM | 301036 | ||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||
Protein general information | Q9BZD6 Name: Transmembrane gamma carboxyglutamic acid protein 4 (Proline rich gamma carboxyglutamic acid protein 4) (Proline rich Gla protein 4) Length: 226 Mass: 25403 Tissue specificity: Expressed in lung, liver, kidney, pancreas and placenta. {ECO | ||||||||||||||||||||||||||||||||||||
Sequence |
MFTLLVLLSQLPTVTLGFPHCARGPKASKHAGEEVFTSKEEANFFIHRRLLYNRFDLELFTPGNLERECNEELCN YEEAREIFVDEDKTIAFWQEYSAKGPTTKSDGNREKIDVMGLLTGLIAAGVFLVIFGLLGYYLCITKCNRLQHPC SSAVYERGRHTPSIIFRRPEEAALSPLPPSVEDAGLPSYEQAVALTRKHSVSPPPPYPGHTKGFRVFKKSMSLPS H | ||||||||||||||||||||||||||||||||||||
Structural information |
| ||||||||||||||||||||||||||||||||||||
Other Databases | GeneCards: PRRG4 Malacards: PRRG4 | ||||||||||||||||||||||||||||||||||||
Gene ontologyExpand All | Collapse All |
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
Diseases
|
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
PubMed referencesExpand All | Collapse All |
|||||||||||||||||||||||||||||||||||||
|