• Gene id: 79056

Gene Summary

• Gene Symbol: PRRG4   Gene   UCSC   Ensembl
• Aliases: PRGP4, TMG4
• Gene name: proline rich and Gla domain 4
• Alternate names: transmembrane gamma-carboxyglutamic acid protein 4, proline rich Gla (G-carboxyglutamic acid) 4 (transmembrane), proline rich Gla 4 (transmembrane) isoform 1, proline rich Gla 4 (transmembrane) isoform 2, proline rich Gla 4 (transmembrane) isoform 3, proline-r,
• Gene location: 11p13 (32829755: 32858119)     Exons: 6     NC_000011.10
• OMIM: 301036

Protein Summary

• Protein general information: Q9BZD6  
  • Name: Transmembrane gamma carboxyglutamic acid protein 4 (Proline rich gamma carboxyglutamic acid protein 4) (Proline rich Gla protein 4)
  • Length: 226  
  • Mass: 25403
  • Tissue specificity: Expressed in lung, liver, kidney, pancreas and placenta. {ECO
• Sequence:

  MFTLLVLLSQLPTVTLGFPHCARGPKASKHAGEEVFTSKEEANFFIHRRLLYNRFDLELFTPGNLERECNEELCN
  YEEAREIFVDEDKTIAFWQEYSAKGPTTKSDGNREKIDVMGLLTGLIAAGVFLVIFGLLGYYLCITKCNRLQHPC
  SSAVYERGRHTPSIIFRRPEEAALSPLPPSVEDAGLPSYEQAVALTRKHSVSPPPPYPGHTKGFRVFKKSMSLPS
  H

• Structural information:
  • Protein Domains: (52..9-)
    (/note="Gla-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00463"-)
  • Interpro: IPR017857  IPR035972  IPR000294  
  • Prosite: PS00011 PS50998
  • STRING: ENSP00000257836
• Other Databases: GeneCards:  PRRG4  Malacards:  PRRG4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	IEA	cellular component
GO:0016021	integral component of membrane	NAS	cellular component
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881