• Gene id: 7905

Gene Summary

• Gene Symbol: REEP5   Gene   UCSC   Ensembl
• Aliases: C5orf18, D5S346, DP1, POB16, TB2, YOP1, Yip2e
• Gene name: receptor accessory protein 5
• Alternate names: receptor expression-enhancing protein 5, deleted in polyposis 1, polyposis coli region hypothetical protein DP1, polyposis locus protein 1,
• Gene location: 5q22.2 (112922288: 112876384)     Exons: 5     NC_000005.10
• OMIM: 125265

Protein Summary

• Protein general information: Q00765  
  • Name: Receptor expression enhancing protein 5 (Polyposis locus protein 1) (Protein TB2)
  • Length: 189  
  • Mass: 21493
  • Tissue specificity: Expressed in circumvallate papillae and testis. {ECO
• Sequence:

  MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAI
  ESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHES
  QMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST

• Structural information:
  • Interpro: IPR004345  
  • STRING: ENSP00000368959
• Other Databases: GeneCards:  REEP5  Malacards:  REEP5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071786	endoplasmic reticulum tubular network organization	IBA	biological process
GO:0071782	endoplasmic reticulum tubular network	IBA	cellular component
GO:0016020	membrane	IBA	cellular component
GO:0071782	endoplasmic reticulum tubular network	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq