• Gene id: 79035

Gene Summary

• Gene Symbol: NABP2   Gene   UCSC   Ensembl
• Aliases: OBFC2B, SOSS-B1, SSB1, hSSB1
• Gene name: nucleic acid binding protein 2
• Alternate names: SOSS complex subunit B1, LP3587, oligonucleotide/oligosaccharide-binding fold containing 2B, oligonucleotide/oligosaccharide-binding fold-containing protein 2B, sensor of single-strand DNA complex subunit B1, sensor of ssDNA subunit B1, single strand DNA-bindin,
• Gene location: 12q13.3 (56222011: 56229857)     Exons: 9     NC_000012.12
• Gene summary(Entrez): Single-stranded DNA (ssDNA)-binding proteins, such as OBFC2B, are ubiquitous and essential for a variety of DNA metabolic processes, including replication, recombination, and detection and repair of damage (Richard et al., 2008 [PubMed 18449195]).[supplie
• OMIM: 607653

Protein Summary

• Protein general information: Q9BQ15  
  • Name: SOSS complex subunit B1 (Nucleic acid binding protein 2) (Oligonucleotide/oligosaccharide binding fold containing protein 2B) (Sensor of single strand DNA complex subunit B1) (Sensor of ssDNA subunit B1) (SOSS B1) (Single stranded DNA binding protein 1) (
  • Length: 211  
  • Mass: 22338
• Sequence:

  MTTETFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGNLIQPGDIIRLTKGYA
  SVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFSEPNPEYSTQQAPNKAVQNDSNPSASQPTTGPSAASPASENQ
  NGNGLSAPPGPGGGPHPPHTPSHPPSTRITRSQPNHTPAGPPGPSSNPVSNGKETRRSSKR

• Structural information:
  • Interpro: IPR012340  IPR004365  
  • PDB: 4OWT 4OWW 4OWX 5D8E 5D8F
  • PDBsum: 4OWT 4OWW 4OWX 5D8E 5D8F
  • STRING: ENSP00000369545
• Other Databases: GeneCards:  NABP2  Malacards:  NABP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070876	SOSS complex	IBA	cellular component
GO:0007093	mitotic cell cycle checkpoint	IBA	biological process
GO:0010212	response to ionizing radiation	IBA	biological process
GO:0003677	DNA binding	IBA	molecular function
GO:0000784	nuclear chromosome, telomeric region	IBA	cellular component
GO:0000724	double-strand break repair via homologous recombination	IBA	biological process
GO:0070876	SOSS complex	IDA	cellular component
GO:0070876	SOSS complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003697	single-stranded DNA binding	IDA	molecular function
GO:0003697	single-stranded DNA binding	IDA	molecular function
GO:0006281	DNA repair	IMP	biological process
GO:0006281	DNA repair	IMP	biological process
GO:0010212	response to ionizing radiation	IMP	biological process
GO:0010212	response to ionizing radiation	IMP	biological process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000724	double-strand break repair via homologous recombination	IMP	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0042795	snRNA transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000784	nuclear chromosome, telomeric region	IEA	cellular component
GO:1904355	positive regulation of telomere capping	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0061730	C-rich strand telomeric DNA binding	IDA	NOT|molecular function
GO:0000784	nuclear chromosome, telomeric region	IDA	cellular component
GO:1904355	positive regulation of telomere capping	IMP	biological process
GO:0070200	establishment of protein localization to telomere	IMP	biological process
GO:0098505	G-rich strand telomeric DNA binding	IDA	molecular function
GO:0006281	DNA repair	ISS	biological process
GO:0070182	DNA polymerase binding	IPI	molecular function
GO:0051972	regulation of telomerase activity	IMP	NOT|biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0007093	mitotic cell cycle checkpoint	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray