• Gene id: 7903

Gene Summary

• Gene Symbol: ST8SIA4   Gene   UCSC   Ensembl
• Aliases: PST, PST1, SIAT8D, ST8SIA-IV
• Gene name: ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4
• Alternate names: CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase, CMP-N-acetylneuraminate-poly-alpha-2,8-sialyl transferase, SIAT8-D, ST8 alpha-N-acetylneuraminate alpha-2,8-sialyltransferase 4, ST8SiaIV, alpha-2,8-sialyltransferase 8D, polysialyltransferase-1, sialyltr,
• Gene location: 5q21.1 (100903281: 100806932)     Exons: 6     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). The encoded protein, which is a
• OMIM: 602547

Protein Summary

• Protein general information: Q92187  
  • Name: CMP N acetylneuraminate poly alpha 2,8 sialyltransferase (EC 2.4.99. ) (Alpha 2,8 sialyltransferase 8D) (Polysialyltransferase 1) (Sialyltransferase 8D) (SIAT8 D) (Sialyltransferase St8Sia IV) (ST8SiaIV)
  • Length: 359  
  • Mass: 41295
  • Tissue specificity: Highly expressed in fetal brain, lung and kidney and in adult heart, spleen and thymus. Present to a lesser extent in adult brain, placenta, lung, large and small intestine and peripheral blood leukocytes.
• Sequence:

  MRSIRKRWTICTISLLLIFYKTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINS
  SLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGI
  LLDSECGKEIDSHNFVIRCNLAPVVEFAADVGTKSDFITMNPSVVQRAFGGFRNESDREKFVHRLSMLNDSVLWI
  PAFMVKGGEKHVEWVNALILKNKLKVRTAYPSLRLIHAVRGYWLTNKVPIKRPSTGLLMYTLATRFCDEIHLYGF
  WPFPKDLNGKAVKYHYYDDLKYRYFSNASPHRMPLEFKTLNVLHNRGALKLTTGKCVKQ

• Structural information:
  • Interpro: IPR001675  IPR038578  IPR012163  
  • PDB: 5Y22 5Y3U 6AHZ
  • PDBsum: 5Y22 5Y3U 6AHZ
  • STRING: ENSP00000231461
• Other Databases: GeneCards:  ST8SIA4  Malacards:  ST8SIA4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006486	protein glycosylation	IBA	biological process
GO:0006491	N-glycan processing	IBA	biological process
GO:0003828	alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	IBA	molecular function
GO:0009311	oligosaccharide metabolic process	IBA	biological process
GO:0006486	protein glycosylation	IEA	biological process
GO:0008373	sialyltransferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0007399	nervous system development	TAS	biological process
GO:0006464	cellular protein modification process	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0003828	alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	IEA	molecular function
GO:0033691	sialic acid binding	IC	molecular function
GO:0003828	alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	IDA	molecular function
GO:0001574	ganglioside biosynthetic process	IDA	biological process
GO:0006486	protein glycosylation	IDA	biological process
GO:0006491	N-glycan processing	IDA	biological process
GO:0009311	oligosaccharide metabolic process	IDA	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0006486	protein glycosylation	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray