• Gene id: 79024

Gene Summary

• Gene Symbol: SMIM2   Gene   UCSC   Ensembl
• Aliases: C13orf44
• Gene name: small integral membrane protein 2
• Alternate names: small integral membrane protein 2,
• Gene location: 13q14.11 (44161256: 44143149)     Exons: 3     NC_000013.11

Protein Summary

• Protein general information: Q9BVW6  
  • Name: Small integral membrane protein 2
  • Length: 85  
  • Mass: 9520
• Sequence:

  MEAGERIDASQLPHRVLETRGHAISILFGFWTSFICDTYIVLAWISKIKGSPDVSASSDEPYARIQQSRRQCHAE
  EDQSQVPEAG

• Structural information:
  • STRING: ENSP00000383270
• Other Databases: GeneCards:  SMIM2  Malacards:  SMIM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray