• Gene id: 79016

Gene Summary

• Gene Symbol: DDA1   Gene   UCSC   Ensembl
• Aliases: C19orf58, PCIA1
• Gene name: DET1 and DDB1 associated 1
• Alternate names: DET1- and DDB1-associated protein 1, cross-immune reaction antigen PCIA1, placenta cross-immune reaction antigen 1,
• Gene location: 19p13.11 (17309562: 17323300)     Exons: 5     NC_000019.10

Protein Summary

• Protein general information: Q9BW61  
  • Name: DET1 and DDB1 associated protein 1 (Placenta cross immune reaction antigen 1) (PCIA 1)
  • Length: 102  
  • Mass: 11835
• Sequence:

  MADFLKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQWDKKNAAKKRDQE
  QVELEGESSAPPRKVARTDSPDMHEDT

• Structural information:
  • Interpro: IPR033575  IPR018276  
  • PDB: 6DSZ 6PAI 6Q0R 6Q0V 6Q0W 6SJ7 6UD7 6UE5
  • PDBsum: 6DSZ 6PAI 6Q0R 6Q0V 6Q0W 6SJ7 6UD7 6UE5
  • DIP: 53527
  • STRING: ENSP00000352928
• Other Databases: GeneCards:  DDA1  Malacards:  DDA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0080008	Cul4-RING E3 ubiquitin ligase complex	IBA	cellular component
GO:0080008	Cul4-RING E3 ubiquitin ligase complex	IDA	cellular component
GO:0080008	Cul4-RING E3 ubiquitin ligase complex	IDA	cellular component
GO:0000209	protein polyubiquitination	IMP	biological process
GO:0032434	regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0080008	Cul4-RING E3 ubiquitin ligase complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray