• Gene id: 79006

Gene Summary

• Gene Symbol: METRN   Gene   UCSC   Ensembl
• Aliases: C16orf23, c380A1.2
• Gene name: meteorin, glial cell differentiation regulator
• Alternate names: meteorin,
• Gene location: 16p13.3 (715117: 719654)     Exons: 28     NC_000016.10
• Gene summary(Entrez): Meteorin regulates glial cell differentiation and promotes the formation of axonal networks during neurogenesis (Nishino et al., 2004 [PubMed 15085178]).[supplied by OMIM, Mar 2008]
• OMIM: 610998

Protein Summary

• Protein general information: Q9UJH8  
  • Name: Meteorin
  • Length: 293  
  • Mass: 31207
• Sequence:

  MGFPAAALLCALCCGLLAPAARAGYSEERCSWRGSGLTQEPGSVGQLALACAEGAVEWLYPAGALRLTLGGPDPR
  ARPGIACLRPVRPFAGAQVFAERAGGALELLLAEGPGPAGGRCVRWGPRERRALFLQATPHQDISRRVAAFRFEL
  REDGRPELPPQAHGLGVDGACRPCSDAELLLAACTSDFVIHGIIHGVTHDVELQESVITVVAARVLRQTPPLFQA
  GRSGDQGLTSIRTPLRCGVHPGPGTFLFMGWSRFGEARLGCAPRFQEFRRAYEAARAAHLHPCEVALH

• Structural information:
  • Interpro: IPR039229  
  • STRING: ENSP00000455068
• Other Databases: GeneCards:  METRN  Malacards:  METRN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050772	positive regulation of axonogenesis	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0010001	glial cell differentiation	IBA	biological process
GO:0005179	hormone activity	IBA	molecular function
GO:0050772	positive regulation of axonogenesis	IEA	biological process
GO:0010001	glial cell differentiation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0050772	positive regulation of axonogenesis	IEA	biological process
GO:0010001	glial cell differentiation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881