• Gene id: 79000

Gene Summary

• Gene Symbol: AUNIP   Gene   UCSC   Ensembl
• Aliases: AIBP, C1orf135
• Gene name: aurora kinase A and ninein interacting protein
• Alternate names: aurora kinase A and ninein-interacting protein, aurora A-binding protein,
• Gene location: 1p36.11 (25859457: 25831912)     Exons: 4     NC_000001.11
• OMIM: 600296

Protein Summary

• Protein general information: Q9H7T9  
  • Name: Aurora kinase A and ninein interacting protein (AIBp)
  • Length: 357  
  • Mass: 40253
  • Tissue specificity: Expressed in heart, skeletal muscles, placenta and testis.
• Sequence:

  MRRTGPEEEACGVWLDAAALKRRKVQTHLIKPGTKMLTLLPGERKANIYFTQRRAPSTGIHQRSIASFFTLQPGK
  TNGSDQKSVSSHTESQINKESKKNATQLDHLIPGLAHDCMASPLATSTTADIQEAGLSPQSLQTSGHHRMKTPFS
  TELSLLQPDTPDCAGDSHTPLAFSFTEDLESSCLLDRKEEKGDSARKWEWLHESKKNYQSMEKHTKLPGDKCCQP
  LGKTKLERKVSAKENRQAPVLLQTYRESWNGENIESVKQSRSPVSVFSWDNEKNDKDSWSQLFTEDSQGQRVIAH
  NTRAPFQDVTNNWNWDLGPFPNSPWAQCQEDGPTQNLKPDLLFTQDSEGNQVIRHQF

• Structural information:
  • Interpro: IPR029286  
  • STRING: ENSP00000443647
• Other Databases: GeneCards:  AUNIP  Malacards:  AUNIP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007051	spindle organization	IBA	biological process
GO:0005813	centrosome	IBA	cellular component
GO:0000922	spindle pole	IBA	cellular component
GO:0090734	site of DNA damage	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:2001033	negative regulation of double-strand break repair via nonhomologous end joining	IDA	biological process
GO:0000724	double-strand break repair via homologous recombination	IDA	biological process
GO:0003684	damaged DNA binding	IDA	molecular function
GO:0000922	spindle pole	IDA	cellular component
GO:0007051	spindle organization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881