• Gene id: 78999

Gene Summary

• Gene Symbol: LRFN4   Gene   UCSC   Ensembl
• Aliases: FIGLER6, SALM3, SALM3.
• Gene name: leucine rich repeat and fibronectin type III domain containing 4
• Alternate names: leucine-rich repeat and fibronectin type-III domain-containing protein 4, fibronectin type III, immunoglobulin and leucine rich repeat domains 6,
• Gene location: 11q13.2 (66857063: 66860474)     Exons: 3     NC_000011.10
• OMIM: 612810

Protein Summary

• Protein general information: Q6PJG9  
  • Name: Leucine rich repeat and fibronectin type III domain containing protein 4
  • Length: 635  
  • Mass: 66860
• Sequence:

  MAPPLLLLLLASGAAACPLPCVCQNLSESLSTLCAHRGLLFVPPNVDRRTVELRLADNFIQALGPPDFRNMTGLV
  DLTLSRNAITRIGARAFGDLESLRSLHLDGNRLVELGTGSLRGPVNLQHLILSGNQLGRIAPGAFDDFLESLEDL
  DLSYNNLRQVPWAGIGAMPALHTLNLDHNLIDALPPGAFAQLGQLSRLDLTSNRLATLAPDPLFSRGRDAEASPA
  PLVLSFSGNPLHCNCELLWLRRLARPDDLETCASPPGLAGRYFWAVPEGEFSCEPPLIARHTQRLWVLEGQRATL
  RCRALGDPAPTMHWVGPDDRLVGNSSRARAFPNGTLEIGVTGAGDAGGYTCIATNPAGEATARVELRVLALPHGG
  NSSAEGGRPGPSDIAASARTAAEGEGTLESEPAVQVTEVTATSGLVSWGPGRPADPVWMFQIQYNSSEDETLIYR
  IVPASSHHFLLKHLVPGADYDLCLLALSPAAGPSDLTATRLLGCAHFSTLPASPLCHALQAHVLGGTLTVAVGGV
  LVAALLVFTVALLVRGRGAGNGRLPLKLSHVQSQTNGGPSPTPKAHPPRSPPPRPQRSCSLDLGDAGCYGYARRL
  GGAWARRSHSVHGGLLGAGCRGVGGSAERLEESVV

• Structural information:
  • Protein Domains: (17..4-)
    (/note="LRRNT-)
    (234..28-)
    (/note="LRRCT-)
    (281..36-)
    (/note="Ig-like-)
    (405..50-)
    (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"-)
  • Interpro: IPR000483  IPR003961  IPR036116  IPR007110  IPR036179   IPR013783  IPR013098  IPR003599  IPR003598  IPR001611  IPR003591  IPR032675  
  • Prosite: PS50853 PS50835
  • CDD: cd00063
  • STRING: ENSP00000312535
• Other Databases: GeneCards:  LRFN4  Malacards:  LRFN4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009986	cell surface	IBA	cellular component
GO:0099061	integral component of postsynaptic density membrane	IBA	cellular component
GO:0099151	regulation of postsynaptic density assembly	IBA	biological process
GO:0099560	synaptic membrane adhesion	IBA	biological process
GO:0098978	glutamatergic synapse	IBA	cellular component
GO:1905606	regulation of presynapse assembly	IBA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0099151	regulation of postsynaptic density assembly	IEA	biological process
GO:0099061	integral component of postsynaptic density membrane	IEA	cellular component
GO:0099560	synaptic membrane adhesion	IEA	biological process
GO:0098982	GABA-ergic synapse	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:1905606	regulation of presynapse assembly	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray