• Gene id: 78997

Gene Summary

• Gene Symbol: GDAP1L1   Gene   UCSC   Ensembl
• Aliases: dJ881L22.1, dJ995J12.1.1
• Gene name: ganglioside induced differentiation associated protein 1 like 1
• Alternate names: ganglioside-induced differentiation-associated protein 1-like 1, GDAP1-L1,
• Gene location: 20q13.12 (44247098: 44280916)     Exons: 7     NC_000020.11
• Gene summary(Entrez): The ganglioside GD3 synthase causes cell differentiation with neurite sprouting when transfected into the mouse neuroblastoma cell line Neuro2a. After differentiation, the expression of several genes is upregulated, including one that encodes a protein te

Protein Summary

• Protein general information: Q96MZ0  
  • Name: Ganglioside induced differentiation associated protein 1 like 1 (GDAP1 L1)
  • Length: 367  
  • Mass: 41,973
• Sequence:

  MATPNNLTPTNCSWWPISALESDAAKPAEAPDAPEAASPAHWPRESLVLYHWTQSFSSQKVRLVIAEKGLVCEER
  DVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFTGEHVVALMPEVGSLQHARVLQYRELLD
  ALPMDAYTHGCILHPELTTDSMIPKYATAEIRRHLANATTDLMKLDHEEEPQLSEPYLSKQKKLMAKILEHDDVS
  YLKKILGELAMVLDQIEAELEKRKLENEGQKCELWLCGCAFTLADVLLGATLHRLKFLGLSKKYWEDGSRPNLQS
  FFERVQRRFAFRKVLGDIHTTLLSAVIPNAFRLVKRKPPSFFGASFLMGSLGGMGYFAYWYLKKKYI

• Structural information:
  • Protein Domains: GST (45-126)
    GST (174-341)
  • Interpro: IPR034336  IPR010987  IPR036282  IPR004045  IPR036249  
  • Prosite: PS50405 PS50404
  • STRING: ENSP00000341782
• Other Databases: GeneCards:  GDAP1L1  Malacards:  GDAP1L1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004364	glutathione transferase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0006749	glutathione metabolic process	IBA	biological process
GO:0004364	glutathione transferase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0006749	glutathione metabolic process	IBA	biological process
GO:0004364	glutathione transferase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0006749	glutathione metabolic process	IBA	biological process

Diseases

Associated diseases	References
Male factor infertility	MIK: 25762640
Globozoospermia	MIK: 25762640
Azoospermia	MIK: 25762640
Azoospermia	MIK: 25762640
Globozoospermia	MIK: 25762640

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25762640	Azoospermia, Globozoospermia				Male infertility	GDAP1L1 GNAS KCNK9 LIN28B RB1 RTL1 SLC22A18 ZDBF2