• Gene id: 78996

Gene Summary

• Gene Symbol: CYREN   Gene   UCSC   Ensembl
• Aliases: C7orf49, MRI, MRI-2
• Gene name: cell cycle regulator of NHEJ
• Alternate names: cell cycle regulator of non-homologous end joining, modulator of retrovirus infection homolog,
• Gene location: 7q33 (135170825: 135092302)     Exons: 7     NC_000007.14
• OMIM: 616980

Protein Summary

• Protein general information: Q9BWK5  
  • Name: Cell cycle regulator of non homologous end joining (Cell cycle regulator of NHEJ) (Modulator of retrovirus infection homolog)
  • Length: 157  
  • Mass: 16829
• Sequence:

  METLQSETKTRVLPSWLTAQVATKNVAPMKAPKRMRMAAVPVAAARLPATRTVYCMNEAEIVDVALGILIESRKQ
  EKACEQPALAGADNPEHSPPCSVSPHTSSGSSSEEEDSGKQALAPGLSPSQRPGGSSSACSRSPEEEEEEDVLKY
  VREIFFS

• Structural information:
  • Interpro: IPR028278  
  • PDB: 6TYU
  • PDBsum: 6TYU
  • STRING: ENSP00000376823
• Other Databases: GeneCards:  CYREN  Malacards:  CYREN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0006303	double-strand break repair via nonhomologous end joining	IBA	biological process
GO:0006303	double-strand break repair via nonhomologous end joining	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:2001033	negative regulation of double-strand break repair via nonhomologous end joining	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2001033	negative regulation of double-strand break repair via nonhomologous end joining	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R