• Gene id: 78989

Gene Summary

• Gene Symbol: COLEC11   Gene   UCSC   Ensembl
• Aliases: 3MC2, CL-K1-I, CL-K1-II, CL-K1-IIa, CL-K1-IIb, CLK1
• Gene name: collectin subfamily member 11
• Alternate names: collectin-11, Collectin K1, collectin kidney protein 1, collectin sub-family member 11,
• Gene location: 2p25.3 (3594831: 3644643)     Exons: 12     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the collectin family of C-type lectins that possess collagen-like sequences and carbohydrate recognition domains. Collectins are secreted proteins that play important roles in the innate immune system by binding to carbohydra
• OMIM: 612502

Protein Summary

• Protein general information: Q9BWP8  
  • Name: Collectin 11 (Collectin kidney protein 1) (CL K1)
  • Length: 271  
  • Mass: 28665
  • Tissue specificity: Ubiquitous (PubMed
• Sequence:

  MRGNLALVGVLISLAFLSLLPSGHPQPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQ
  KGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETE
  SKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTF
  NKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM

• Structural information:
  • Protein Domains: (65..11-)
    (/note="Collagen-like-)
    (149..26-)
    (/note="C-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00040"-)
  • Interpro: IPR001304  IPR016186  IPR018378  IPR008160  IPR033990   IPR016187  
  • Prosite: PS00615 PS50041
  • CDD: cd03591
  • PDB: 4YLI 4YMD
  • PDBsum: 4YLI 4YMD
  • STRING: ENSP00000411770
• Other Databases: GeneCards:  COLEC11  Malacards:  COLEC11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0006956	complement activation	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005509	calcium ion binding	IDA	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0120153	calcium-dependent carbohydrate binding	IDA	molecular function
GO:0097194	execution phase of apoptosis	IC	biological process
GO:0005537	mannose binding	IDA	molecular function
GO:0070492	oligosaccharide binding	IDA	molecular function
GO:0019730	antimicrobial humoral response	IDA	biological process
GO:0003677	DNA binding	IDA	molecular function
GO:0005537	mannose binding	IDA	molecular function
GO:0042806	fucose binding	IDA	molecular function
GO:0001867	complement activation, lectin pathway	IMP	biological process
GO:0032502	developmental process	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0005537	mannose binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0005581	collagen trimer	IEA	cellular component
GO:0006898	receptor-mediated endocytosis	TAS	biological process
GO:0001867	complement activation, lectin pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0006956	complement activation	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04145	Phagosome

Diseases

Associated diseases	References
3MC syndrome	KEGG:H01887
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray