• Gene id: 78988

Gene Summary

• Gene Symbol: MRPL57   Gene   UCSC   Ensembl
• Aliases: MRP63, bMRP63
• Gene name: mitochondrial ribosomal protein L57
• Alternate names: ribosomal protein 63, mitochondrial, hMRP63, mitochondrial large ribosomal subunit protein mL63, mitochondrial ribosomal protein 63, mitochondrial ribosomal protein bMRP63,
• Gene location: 13q12.11 (21176648: 21179083)     Exons: 23     NC_000013.11
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 611997

Protein Summary

• Protein general information: Q9BQC6  
  • Name: Ribosomal protein 63, mitochondrial (hMRP63) (Mitochondrial large ribosomal subunit protein mL63) (Mitochondrial ribosomal protein 63) (Mitochondrial ribosomal protein L57)
  • Length: 102  
  • Mass: 12266
• Sequence:

  MFLTALLWRGRIPGRQWIGKHRRPRFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQERGHAAVRRREAFEAIK
  AAATSKFPPHRFIADQLDHLNVTKKWS

• Structural information:
  • Interpro: IPR016576  
  • PDB: 3J7Y 3J9M 5OOL 5OOM 6NU2 6NU3
  • PDBsum: 3J7Y 3J9M 5OOL 5OOM 6NU2 6NU3
  • STRING: ENSP00000310726
• Other Databases: GeneCards:  MRPL57  Malacards:  MRPL57

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006412	translation	IBA	biological process
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0005739	mitochondrion	IBA	cellular component
GO:0005761	mitochondrial ribosome	IBA	cellular component
GO:0005762	mitochondrial large ribosomal subunit	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005761	mitochondrial ribosome	IEA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006412	translation	IEA	biological process
GO:0005761	mitochondrial ribosome	IEA	cellular component
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0032543	mitochondrial translation	ISS	biological process
GO:0005761	mitochondrial ribosome	ISS	cellular component
GO:0003735	structural constituent of ribosome	ISS	molecular function

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray