• Gene id: 7884

Gene Summary

• Gene Symbol: SLBP   Gene   UCSC   Ensembl
• Aliases: HBP
• Gene name: stem-loop binding protein
• Alternate names: histone RNA hairpin-binding protein, hairpin binding protein, histone, histone binding protein, histone stem-loop binding protein, stem-loop (histone) binding protein,
• Gene location: 4p16.3 (1715875: 1692730)     Exons: 8     NC_000004.12
• Gene summary(Entrez): This gene encodes a protein that binds to the stem-loop structure in replication-dependent histone mRNAs. Histone mRNAs do not contain introns or polyadenylation signals, and are processed by endonucleolytic cleavage. The stem-loop structure is essential
• OMIM: 602422

Protein Summary

• Protein general information: Q14493  
  • Name: Histone RNA hairpin binding protein (Histone stem loop binding protein)
  • Length: 270  
  • Mass: 31286
  • Tissue specificity: Widely expressed.
• Sequence:

  MACRPRSPPRHQSRCDGDASPPSPARWSLGRKRRADGRRWRPEDAEEAEHRGAERRPESFTTPEGPKPRSRCSDW
  ASAVEEDEMRTRVNKEMARYKRKLLINDFGRERKSSSGSSDSKESMSTVPADFETDESVLMRRQKQINYGKNTIA
  YDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWKVALHFWDPPAEEGCDLQEIHPVDLESAESSSEPQ
  TSSQDDFDVYSGTPTKVRHMDSQVEDEFDLEACLTEPLRDFSAMS

• Structural information:
  • Interpro: IPR026502  IPR029344  IPR038294  
  • PDB: 2KJM 4L8R 4QOZ
  • PDBsum: 2KJM 4L8R 4QOZ
  • DIP: 57045
  • STRING: ENSP00000417686
• Other Databases: GeneCards:  SLBP  Malacards:  SLBP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003729	mRNA binding	IBA	molecular function
GO:0006398	mRNA 3'-end processing by stem-loop binding and cleavage	IBA	biological process
GO:0051028	mRNA transport	IBA	biological process
GO:0071207	histone pre-mRNA stem-loop binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0071204	histone pre-mRNA 3'end processing complex	IBA	cellular component
GO:0071207	histone pre-mRNA stem-loop binding	ISS	molecular function
GO:0006398	mRNA 3'-end processing by stem-loop binding and cleavage	ISS	biological process
GO:0071208	histone pre-mRNA DCP binding	ISS	molecular function
GO:0071204	histone pre-mRNA 3'end processing complex	ISS	cellular component
GO:0071204	histone pre-mRNA 3'end processing complex	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003729	mRNA binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:1990904	ribonucleoprotein complex	TAS	cellular component
GO:0006369	termination of RNA polymerase II transcription	TAS	biological process
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0008334	histone mRNA metabolic process	TAS	biological process
GO:0008334	histone mRNA metabolic process	TAS	biological process
GO:0008334	histone mRNA metabolic process	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990904	ribonucleoprotein complex	IEA	cellular component
GO:0071207	histone pre-mRNA stem-loop binding	IEA	molecular function
GO:0006398	mRNA 3'-end processing by stem-loop binding and cleavage	IEA	biological process
GO:0003729	mRNA binding	IEA	molecular function
GO:0071204	histone pre-mRNA 3'end processing complex	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003729	mRNA binding	IDA	molecular function
GO:0051028	mRNA transport	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray