• Gene id: 7873

Gene Summary

• Gene Symbol: MANF   Gene   UCSC   Ensembl
• Aliases: ARMET, ARP
• Gene name: mesencephalic astrocyte derived neurotrophic factor
• Alternate names: mesencephalic astrocyte-derived neurotrophic factor, arginine-rich, mutated in early stage tumors,
• Gene location: 3p21.2 (93576583: 93679586)     Exons: 22     NC_000009.12
• Gene summary(Entrez): The protein encoded by this gene is localized in the endoplasmic reticulum (ER) and golgi, and is also secreted. Reducing expression of this gene increases susceptibility to ER stress-induced death and results in cell proliferation. Activity of this prote
• OMIM: 601916

Protein Summary

• Protein general information: P55145  
  • Name: Mesencephalic astrocyte derived neurotrophic factor (Arginine rich protein) (Protein ARMET)
  • Length: 182  
  • Mass: 20700
• Sequence:

  MRRMWATQGLAVALALSVLPGSRALRPGDCEVCISYLGRFYQDLKDRDVTFSPATIENELIKFCREARGKENRLC
  YYIGATDDAATKIINEVSKPLAHHIPVEKICEKLKKKDSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGET
  CKGCAEKSDYIRKINELMPKYAPKAASARTDL

• Structural information:
  • Interpro: IPR019345  IPR036361  
  • PDB: 2KVD 2KVE 2W51
  • PDBsum: 2KVD 2KVE 2W51
  • STRING: ENSP00000432799
• Other Databases: GeneCards:  MANF  Malacards:  MANF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0031175	neuron projection development	IBA	biological process
GO:0071542	dopaminergic neuron differentiation	IBA	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016529	sarcoplasmic reticulum	IEA	cellular component
GO:0006986	response to unfolded protein	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008083	growth factor activity	IEA	molecular function
GO:0002576	platelet degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0033018	sarcoplasmic reticulum lumen	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005788	endoplasmic reticulum lumen	IDA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0120146	sulfatide binding	IPI	molecular function
GO:1905897	regulation of response to endoplasmic reticulum stress	IMP	biological process
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Breast cancer	PMID:8971156
Squamous cell carcinoma	PMID:8971156
pancreatic cancer	PMID:9174057
lung non-small cell carcinoma	PMID:8971156
renal cell carcinoma	PMID:8649854
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray