• Gene id: 7869

Gene Summary

• Gene Symbol: SEMA3B   Gene   UCSC   Ensembl
• Aliases: LUCA-1, SEMA5, SEMAA, SemA, semaV
• Gene name: semaphorin 3B
• Alternate names: semaphorin-3B, sema A(V), sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B, semaphorin A, semaphorin-V,
• Gene location: 3p21.31 (50267557: 50277545)     Exons: 18     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the class-3 semaphorin/collapsin family, whose members function in growth cone guidance during neuronal development. This family member inhibits axonal extension and has been shown to act as a tumor suppressor b

Protein Summary

• Protein general information: Q13214  
  • Name: Semaphorin 3B (Sema A(V)) (Semaphorin V) (Sema V)
  • Length: 749  
  • Mass: 83122
  • Tissue specificity: Expressed abundantly but differentially in a variety of neural and nonneural tissues.
• Sequence:

  MGRAGAAAVIPGLALLWAVGLGSAAPSPPRLRLSFQELQAWHGLQTFSLERTCCYQALLVDEERGRLFVGAENHV
  ASLNLDNISKRAKKLAWPAPVEWREECNWAGKDIGTECMNFVKLLHAYNRTHLLACGTGAFHPTCAFVEVGHRAE
  EPVLRLDPGRIEDGKGKSPYDPRHRAASVLVGEELYSGVAADLMGRDFTIFRSLGQRPSLRTEPHDSRWLNEPKF
  VKVFWIPESENPDDDKIYFFFRETAVEAAPALGRLSVSRVGQICRNDVGGQRSLVNKWTTFLKARLVCSVPGVEG
  DTHFDQLQDVFLLSSRDHRTPLLYAVFSTSSSIFQGSAVCVYSMNDVRRAFLGPFAHKEGPMHQWVSYQGRVPYP
  RPGMCPSKTFGTFSSTKDFPDDVIQFARNHPLMYNSVLPTGGRPLFLQVGANYTFTQIAADRVAAADGHYDVLFI
  GTDVGTVLKVISVPKGSRPSAEGLLLEELHVFEDSAAVTSMQISSKRHQLYVASRSAVAQIALHRCAAHGRVCTE
  CCLARDPYCAWDGVACTRFQPSAKRRFRRQDVRNGDPSTLCSGDSSRPALLEHKVFGVEGSSAFLECEPRSLQAR
  VEWTFQRAGVTAHTQVLAEERTERTARGLLLRRLRRRDSGVYLCAAVEQGFTQPLRRLSLHVLSATQAERLARAE
  EAAPAAPPGPKLWYRDFLQLVEPGGGGSANSLRMCRPQPALQSLPLESRRKGRNRRTHAPEPRAERGPRSATHW

• Structural information:
  • Protein Domains: (30..51-)
    (/note="Sema-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00352-)
    (573..65-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR013151   IPR016201  IPR001627  IPR036352  IPR027231  IPR015943  
  • Prosite: PS50835 PS51004
  • STRING: ENSP00000484146
• Other Databases: GeneCards:  SEMA3B  Malacards:  SEMA3B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045499	chemorepellent activity	TAS	molecular function
GO:0061643	chemorepulsion of axon	TAS	biological process
GO:0001755	neural crest cell migration	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007411	axon guidance	IBA	biological process
GO:0048843	negative regulation of axon extension involved in axon guidance	IBA	biological process
GO:0050919	negative chemotaxis	IBA	biological process
GO:0071526	semaphorin-plexin signaling pathway	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0030215	semaphorin receptor binding	IBA	molecular function
GO:0030335	positive regulation of cell migration	IBA	biological process
GO:0045499	chemorepellent activity	IBA	molecular function
GO:0030215	semaphorin receptor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0007411	axon guidance	TAS	biological process
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0007267	cell-cell signaling	TAS	biological process
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881