• Gene id: 7867

Gene Summary

• Gene Symbol: MAPKAPK3   Gene   UCSC   Ensembl
• Aliases: 3PK, MAPKAP-K3, MAPKAP3, MAPKAPK-3, MDPT3, MK-3, MK3
• Gene name: MAPK activated protein kinase 3
• Alternate names: MAP kinase-activated protein kinase 3, MAPKAP kinase 3, chromosome 3p kinase, mitogen-activated protein kinase-activated protein kinase 3,
• Gene location: 3p21.2 (50611861: 50649296)     Exons: 14     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the Ser/Thr protein kinase family. This kinase functions as a mitogen-activated protein kinase (MAP kinase)- activated protein kinase. MAP kinases are also known as extracellular signal-regulated kinases (ERKs), act as an int
• OMIM: 131370

Protein Summary

• Protein general information: Q16644  
  • Name: MAP kinase activated protein kinase 3 (MAPK activated protein kinase 3) (MAPKAP kinase 3) (MAPKAP K3) (MAPKAPK 3) (MK 3) (EC 2.7.11.1) (Chromosome 3p kinase) (3pK)
  • Length: 382  
  • Mass: 42987
  • Tissue specificity: Widely expressed, with a higher expression level observed in heart and skeletal muscle. No expression in brain. Expressed in the retinal pigment epithelium (PubMed
• Sequence:

  MDGETAEEQGGPVPPPVAPGGPGLGGAPGGRREPKKYAVTDDYQLSKQVLGLGVNGKVLECFHRRTGQKCALKLL
  YDSPKARQEVDHHWQASGGPHIVCILDVYENMHHGKRCLLIIMECMEGGELFSRIQERGDQAFTEREAAEIMRDI
  GTAIQFLHSHNIAHRDVKPENLLYTSKEKDAVLKLTDFGFAKETTQNALQTPCYTPYYVAPEVLGPEKYDKSCDM
  WSLGVIMYILLCGFPPFYSNTGQAISPGMKRRIRLGQYGFPNPEWSEVSEDAKQLIRLLLKTDPTERLTITQFMN
  HPWINQSMVVPQTPLHTARVLQEDKDHWDEVKEEMTSALATMRVDYDQVKIKDLKTSNNRLLNKRRKKQAGSSSA
  SQGCNNQ

• Structural information:
  • Protein Domains: (44..30-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR027442  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 3FHR 3FXW 3R1N 3SHE
  • PDBsum: 3FHR 3FXW 3R1N 3SHE
  • STRING: ENSP00000396467
• Other Databases: GeneCards:  MAPKAPK3  Malacards:  MAPKAPK3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051019	mitogen-activated protein kinase binding	IBA	molecular function
GO:0046777	protein autophosphorylation	IBA	biological process
GO:0034097	response to cytokine	IBA	biological process
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0009931	calcium-dependent protein serine/threonine kinase activity	IBA	molecular function
GO:0005516	calmodulin binding	IBA	molecular function
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0002224	toll-like receptor signaling pathway	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0044351	macropinocytosis	ISS	biological process
GO:0032496	response to lipopolysaccharide	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0002224	toll-like receptor signaling pathway	ISS	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004708	MAP kinase kinase activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002224	toll-like receptor signaling pathway	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0044351	macropinocytosis	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0000165	MAPK cascade	IEA	biological process
GO:0034097	response to cytokine	IDA	biological process
GO:0051019	mitogen-activated protein kinase binding	IBA	molecular function
GO:0046777	protein autophosphorylation	IBA	biological process
GO:0034097	response to cytokine	IBA	biological process
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0009931	calcium-dependent protein serine/threonine kinase activity	IBA	molecular function
GO:0005516	calmodulin binding	IBA	molecular function
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0002224	toll-like receptor signaling pathway	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0044351	macropinocytosis	ISS	biological process
GO:0032496	response to lipopolysaccharide	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0002224	toll-like receptor signaling pathway	ISS	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004708	MAP kinase kinase activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002224	toll-like receptor signaling pathway	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0044351	macropinocytosis	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0000165	MAPK cascade	IEA	biological process
GO:0034097	response to cytokine	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa04370	VEGF signaling pathway

Diseases

Associated diseases	References
Pattern dystrophies of the retinal pigment epithelium	KEGG:H01890
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881