• Gene id: 7857

Gene Summary

• Gene Symbol: SCG2   Gene   UCSC   Ensembl
• Aliases: CHGC, EM66, SN, SgII
• Gene name: secretogranin II
• Alternate names: secretogranin-2, chromogranin-C, secretoneurin,
• Gene location: 2q36.1 (223602360: 223596939)     Exons: 2     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Studies in rodents suggest that the full-length protein, secretogranin II, is involved in the packaging or sorting of peptide hormo
• OMIM: 109280

Protein Summary

• Protein general information: P13521  
  • Name: Secretogranin 2 (Chromogranin C) (Secretogranin II) (SgII) [Cleaved into: Secretoneurin (SN); Manserin]
  • Length: 617  
  • Mass: 70941
• Sequence:

  MAEAKTHWLGAALSLIPLIFLISGAEAASFQRNQLLQKEPDLRLENVQKFPSPEMIRALEYIENLRQQAHKEESS
  PDYNPYQGVSVPLQQKENGDESHLPERDSLSEEDWMRIILEALRQAENEPQSAPKENKPYALNSEKNFPMDMSDD
  YETQQWPERKLKHMQFPPMYEENSRDNPFKRTNEIVEEQYTPQSLATLESVFQELGKLTGPNNQKRERMDEEQKL
  YTDDEDDIYKANNIAYEDVVGGEDWNPVEEKIESQTQEEVRDSKENIEKNEQINDEMKRSGQLGIQEEDLRKESK
  DQLSDDVSKVIAYLKRLVNAAGSGRLQNGQNGERATRLFEKPLDSQSIYQLIEISRNLQIPPEDLIEMLKTGEKP
  NGSVEPERELDLPVDLDDISEADLDHPDLFQNRMLSKSGYPKTPGRAGTEALPDGLSVEDILNLLGMESAANQKT
  SYFPNPYNQEKVLPRLPYGAGRSRSNQLPKAAWIPHVENRQMAYENLNDKDQELGEYLARMLVKYPEIINSNQVK
  RVPGQGSSEDDLQEEEQIEQAIKEHLNQGSSQETDKLAPVSKRFPVGPPKNDDTPNRQYWDEDLLMKVLEYLNQE
  KAEKGREHIAKRAMENM

• Structural information:
  • Interpro: IPR018054  IPR001990  IPR038858  
  • Prosite: PS00422
  • STRING: ENSP00000304133
• Other Databases: GeneCards:  SCG2  Malacards:  SCG2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IDA	cellular component
GO:0005125	cytokine activity	IDA	molecular function
GO:0006954	inflammatory response	TAS	biological process
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0001525	angiogenesis	IDA	biological process
GO:0042056	chemoattractant activity	IDA	molecular function
GO:0043542	endothelial cell migration	TAS	biological process
GO:0001937	negative regulation of endothelial cell proliferation	TAS	biological process
GO:0048245	eosinophil chemotaxis	IDA	biological process
GO:0000165	MAPK cascade	IDA	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IDA	biological process
GO:0050930	induction of positive chemotaxis	IDA	biological process
GO:0001525	angiogenesis	IBA	biological process
GO:0005125	cytokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0030141	secretory granule	IBA	cellular component
GO:0048245	eosinophil chemotaxis	IBA	biological process
GO:0042056	chemoattractant activity	IBA	molecular function
GO:0030141	secretory granule	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0009306	protein secretion	TAS	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001525	angiogenesis	IEA	biological process
GO:0031045	dense core granule	IEA	cellular component
GO:0098992	neuronal dense core vesicle	IEA	cellular component
GO:0050918	positive chemotaxis	IDA	biological process
GO:2000352	negative regulation of endothelial cell apoptotic process	IDA	biological process
GO:2001237	negative regulation of extrinsic apoptotic signaling pathway	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005125	cytokine activity	IDA	molecular function
GO:0006954	inflammatory response	TAS	biological process
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0001525	angiogenesis	IDA	biological process
GO:0042056	chemoattractant activity	IDA	molecular function
GO:0043542	endothelial cell migration	TAS	biological process
GO:0001937	negative regulation of endothelial cell proliferation	TAS	biological process
GO:0048245	eosinophil chemotaxis	IDA	biological process
GO:0000165	MAPK cascade	IDA	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IDA	biological process
GO:0050930	induction of positive chemotaxis	IDA	biological process
GO:0001525	angiogenesis	IBA	biological process
GO:0005125	cytokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0030141	secretory granule	IBA	cellular component
GO:0048245	eosinophil chemotaxis	IBA	biological process
GO:0042056	chemoattractant activity	IBA	molecular function
GO:0030141	secretory granule	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0009306	protein secretion	TAS	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001525	angiogenesis	IEA	biological process
GO:0031045	dense core granule	IEA	cellular component
GO:0098992	neuronal dense core vesicle	IEA	cellular component
GO:0050918	positive chemotaxis	IDA	biological process
GO:2000352	negative regulation of endothelial cell apoptotic process	IDA	biological process
GO:2001237	negative regulation of extrinsic apoptotic signaling pathway	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R