• Gene id: 7855

Gene Summary

• Gene Symbol: FZD5   Gene   UCSC   Ensembl
• Aliases: C2orf31, HFZ5
• Gene name: frizzled class receptor 5
• Alternate names: frizzled-5, Wnt receptor, frizzled 5, seven transmembrane spanning receptor, frizzled family receptor 5, fz-5, fzE5, seven-transmembrane receptor frizzled-5,
• Gene location: 2q33.3 (207769905: 207753888)     Exons: 4     NC_000002.12
• Gene summary(Entrez): Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand. [provided by RefSeq, Jul 2008]
• OMIM: 605925

Protein Summary

• Protein general information: Q13467  
  • Name: Frizzled 5 (Fz 5) (hFz5) (FzE5)
  • Length: 585  
  • Mass: 64507
• Sequence:

  MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVE
  IQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDY
  NRSEATTAPPRPFPAKPTLPGPPGAPASGGECPAGGPFVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQP
  SFSADERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
  EHNHIHYETTGPALCTIVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITA
  LALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIKQGGTKTDKLEKLMIRI
  GIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGHDTGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGK
  TVESWRRFTSRCCCRPRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAATYHKQVSLSHV

• Structural information:
  • Protein Domains: (28..15-)
    (/note="FZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00090"-)
  • Interpro: IPR015526  IPR000539  IPR020067  IPR036790  IPR037441   IPR017981  
  • Prosite: PS50038 PS50261
  • CDD: cd07460
  • PDB: 5URY 5URZ 6O39
  • PDBsum: 5URY 5URZ 6O39
  • STRING: ENSP00000354607
• Other Databases: GeneCards:  FZD5  Malacards:  FZD5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001540	amyloid-beta binding	IPI	molecular function
GO:0001540	amyloid-beta binding	IPI	molecular function
GO:0001540	amyloid-beta binding	IPI	molecular function
GO:0017147	Wnt-protein binding	TAS	molecular function
GO:0044877	protein-containing complex binding	IPI	molecular function
GO:1904469	positive regulation of tumor necrosis factor secretion	ISS	biological process
GO:0050718	positive regulation of interleukin-1 beta secretion	ISS	biological process
GO:0042813	Wnt-activated receptor activity	TAS	molecular function
GO:1903146	regulation of autophagy of mitochondrion	HMP	biological process
GO:0001540	amyloid-beta binding	TAS	molecular function
GO:1903955	positive regulation of protein targeting to mitochondrion	HMP	biological process
GO:0007416	synapse assembly	TAS	biological process
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0002726	positive regulation of T cell cytokine production	IDA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IBA	cellular component
GO:0017147	Wnt-protein binding	IBA	molecular function
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0042813	Wnt-activated receptor activity	IBA	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042813	Wnt-activated receptor activity	IEA	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0017147	Wnt-protein binding	IEA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0042813	Wnt-activated receptor activity	IDA	molecular function
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0017147	Wnt-protein binding	IPI	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007223	Wnt signaling pathway, calcium modulating pathway	TAS	biological process
GO:0030669	clathrin-coated endocytic vesicle membrane	TAS	cellular component
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	TAS	biological process
GO:0031901	early endosome membrane	TAS	cellular component
GO:1904886	beta-catenin destruction complex disassembly	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042813	Wnt-activated receptor activity	IDA	molecular function
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:1901382	regulation of chorionic trophoblast cell proliferation	IEA	biological process
GO:0060718	chorionic trophoblast cell differentiation	IEA	biological process
GO:0060716	labyrinthine layer blood vessel development	IEA	biological process
GO:0060715	syncytiotrophoblast cell differentiation involved in labyrinthine layer development	IEA	biological process
GO:0060561	apoptotic process involved in morphogenesis	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0001944	vasculature development	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:2000810	regulation of bicellular tight junction assembly	IEA	biological process
GO:1904469	positive regulation of tumor necrosis factor secretion	IEA	biological process
GO:0060670	branching involved in labyrinthine layer morphogenesis	IEA	biological process
GO:0060070	canonical Wnt signaling pathway	IEA	biological process
GO:0050718	positive regulation of interleukin-1 beta secretion	IEA	biological process
GO:0048596	embryonic camera-type eye morphogenesis	IEA	biological process
GO:0048469	cell maturation	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0043507	positive regulation of JUN kinase activity	IEA	biological process
GO:0033077	T cell differentiation in thymus	IEA	biological process
GO:0031077	post-embryonic camera-type eye development	IEA	biological process
GO:0031076	embryonic camera-type eye development	IEA	biological process
GO:0017147	Wnt-protein binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0042813	Wnt-activated receptor activity	IC	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0017147	Wnt-protein binding	IPI	molecular function
GO:0017147	Wnt-protein binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0060061	Spemann organizer formation	IDA	biological process
GO:0071219	cellular response to molecule of bacterial origin	IDA	biological process
GO:0000578	embryonic axis specification	IDA	biological process
GO:0008595	anterior/posterior axis specification, embryo	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IGI	biological process
GO:0060070	canonical Wnt signaling pathway	IMP	biological process
GO:0030424	axon	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0030182	neuron differentiation	ISS	biological process
GO:0017147	Wnt-protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05010	Alzheimer disease
hsa05165	Human papillomavirus infection
hsa05205	Proteoglycans in cancer
hsa04310	Wnt signaling pathway
hsa04150	mTOR signaling pathway
hsa04390	Hippo signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa04916	Melanogenesis
hsa05217	Basal cell carcinoma

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq