• Gene id: 7852

Gene Summary

• Gene Symbol: CXCR4   Gene   UCSC   Ensembl
• Aliases: CD184, D2S201E, FB22, HM89, HSY3RR, LAP-3, LAP3, LCR1, LESTR, NPY3R, NPYR, NPYRL, NPYY3R, WHIM, WHIMS
• Gene name: C-X-C motif chemokine receptor 4
• Alternate names: C-X-C chemokine receptor type 4, CD184 antigen, LPS-associated protein 3, SDF-1 receptor, chemokine (C-X-C motif) receptor 4, chemokine receptor, fusin, leukocyte-derived seven transmembrane domain receptor, lipopolysaccharide-associated protein 3, neuropeptide Y ,
• Gene location: 2q22.1 (31065716: 30931505)     Exons: 22     NC_000001.11
• Gene summary(Entrez): This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in
• OMIM: 162643

Protein Summary

• Protein general information: P61073  
  • Name: C X C chemokine receptor type 4 (CXC R4) (CXCR 4) (FB22) (Fusin) (HM89) (LCR1) (Leukocyte derived seven transmembrane domain receptor) (LESTR) (Lipopolysaccharide associated protein 3) (LAP 3) (LPS associated protein 3) (NPYRL) (Stromal cell derived facto
  • Length: 352  
  • Mass: 39746
  • Tissue specificity: Expressed in numerous tissues, such as peripheral blood leukocytes, spleen, thymus, spinal cord, heart, placenta, lung, liver, skeletal muscle, kidney, pancreas, cerebellum, cerebral cortex and medulla (in microglia as well as in astro
• Sequence:

  MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDK
  YRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKL
  LAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISK
  LSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI
  LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS

• Structural information:
  • Interpro: IPR022726  IPR000355  IPR001277  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • PDB: 2K03 2K04 2K05 2N55 3ODU 3OE0 3OE6 3OE8 3OE9 4RWS
  • PDBsum: 2K03 2K04 2K05 2N55 3ODU 3OE0 3OE6 3OE8 3OE9 4RWS
  • DIP: 34773 46290
  • STRING: ENSP00000386884
• Other Databases: GeneCards:  CXCR4  Malacards:  CXCR4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009986	cell surface	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:2000448	positive regulation of macrophage migration inhibitory factor signaling pathway	IMP	biological process
GO:0022008	neurogenesis	IBA	biological process
GO:0019957	C-C chemokine binding	IBA	molecular function
GO:0060326	cell chemotaxis	IBA	biological process
GO:0019956	chemokine binding	IBA	molecular function
GO:0019722	calcium-mediated signaling	IBA	biological process
GO:0016493	C-C chemokine receptor activity	IBA	molecular function
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0007420	brain development	IBA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0006935	chemotaxis	IBA	biological process
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0071345	cellular response to cytokine stimulus	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0038147	C-X-C motif chemokine 12 receptor activity	IDA	molecular function
GO:0030155	regulation of cell adhesion	IDA	biological process
GO:0038160	CXCL12-activated CXCR4 signaling pathway	IDA	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0050920	regulation of chemotaxis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0038160	CXCL12-activated CXCR4 signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004950	chemokine receptor activity	IEA	molecular function
GO:0019955	cytokine binding	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0001618	virus receptor activity	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0015026	coreceptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0006915	apoptotic process	TAS	biological process
GO:0005737	cytoplasm	TAS	cellular component
GO:0006954	inflammatory response	TAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	TAS	biological process
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0009615	response to virus	TAS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0019722	calcium-mediated signaling	IMP	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007411	axon guidance	TAS	biological process
GO:0019064	fusion of virus membrane with host plasma membrane	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001764	neuron migration	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0014823	response to activity	IEA	biological process
GO:0016477	cell migration	IEA	biological process
GO:0022008	neurogenesis	IEA	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0035470	positive regulation of vascular wound healing	IEA	biological process
GO:0035690	cellular response to drug	IEA	biological process
GO:0043278	response to morphine	IEA	biological process
GO:0050769	positive regulation of neurogenesis	IEA	biological process
GO:0050921	positive regulation of chemotaxis	IEA	biological process
GO:0050966	detection of mechanical stimulus involved in sensory perception of pain	IEA	biological process
GO:0051924	regulation of calcium ion transport	IEA	biological process
GO:0061154	endothelial tube morphogenesis	IEA	biological process
GO:1990478	response to ultrasound	IEA	biological process
GO:0002064	epithelial cell development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0008038	neuron recognition	IEA	biological process
GO:0008144	drug binding	IEA	molecular function
GO:0016494	C-X-C chemokine receptor activity	IEA	molecular function
GO:0022029	telencephalon cell migration	IEA	biological process
GO:0043067	regulation of programmed cell death	IEA	biological process
GO:0045446	endothelial cell differentiation	IEA	biological process
GO:0050792	regulation of viral process	IEA	biological process
GO:0050920	regulation of chemotaxis	IEA	biological process
GO:0050965	detection of temperature stimulus involved in sensory perception of pain	IEA	biological process
GO:0060048	cardiac muscle contraction	IEA	biological process
GO:1903861	positive regulation of dendrite extension	IEA	biological process
GO:1905322	positive regulation of mesenchymal stem cell migration	IEA	biological process
GO:0002407	dendritic cell chemotaxis	TAS	biological process
GO:0043217	myelin maintenance	ISS	biological process
GO:0048714	positive regulation of oligodendrocyte differentiation	ISS	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005770	late endosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0032991	protein-containing complex	IMP	cellular component
GO:0019957	C-C chemokine binding	IPI	molecular function
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0003779	actin binding	IDA	molecular function
GO:0032027	myosin light chain binding	IDA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0043130	ubiquitin binding	IDA	molecular function
GO:0031252	cell leading edge	IDA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IDA	biological process
GO:0005769	early endosome	IDA	colocalizes with
GO:0005764	lysosome	IDA	colocalizes with
GO:0016494	C-X-C chemokine receptor activity	NAS	molecular function
GO:0001666	response to hypoxia	IEP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04144	Endocytosis
hsa04060	Cytokine-cytokine receptor interaction
hsa04810	Regulation of actin cytoskeleton
hsa05163	Human cytomegalovirus infection
hsa04020	Calcium signaling pathway
hsa04062	Chemokine signaling pathway
hsa04360	Axon guidance
hsa05170	Human immunodeficiency virus 1 infection
hsa04670	Leukocyte transendothelial migration
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa04672	Intestinal immune network for IgA production

Diseases

Associated diseases	References
Paroxysmal nocturnal hemoglobinuria	PMID:22206707
Waldenstroem's macroglobulinemia	PMID:24711662
Osteoporosis	PMID:29882473
Hermansky-Pudlak syndrome	PMID:25347450
pancreatic adenocarcinoma	PMID:21448932
Acute T cell leukemia	PMID:26931577
Leukopenia	PMID:21890643
acute myeloid leukemia	PMID:24035716
acute myeloid leukemia	PMID:26031918
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray