About Us

Search Result


Gene id 7850
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol IL1R2   Gene   UCSC   Ensembl
Aliases CD121b, CDw121b, IL-1R-2, IL-1RT-2, IL-1RT2, IL1R2c, IL1RB
Gene name interleukin 1 receptor type 2
Alternate names interleukin-1 receptor type 2, CD121 antigen-like family member B, IL-1 type II receptor, IL-1R-beta, antigen CDw121b, interleukin 1 receptor type II variant 3, interleukin-1 receptor beta, interleukin-1 receptor type II, type II interleukin-1 receptor, b,
Gene location 2q11.2 (101991804: 102028543)     Exons: 15     NC_000002.12
Gene summary(Entrez) The protein encoded by this gene is a cytokine receptor that belongs to the interleukin 1 receptor family. This protein binds interleukin alpha (IL1A), interleukin beta (IL1B), and interleukin 1 receptor, type I(IL1R1/IL1RA), and acts as a decoy receptor
OMIM 147811

Protein Summary

Protein general information P27930  

Name: Interleukin 1 receptor type 2 (IL 1R 2) (IL 1RT 2) (IL 1RT2) (CD121 antigen like family member B) (CDw121b) (IL 1 type II receptor) (Interleukin 1 receptor beta) (IL 1R beta) (Interleukin 1 receptor type II) (CD antigen CD121b) [Cleaved into: Interleukin

Length: 398  Mass: 45,421

Sequence MLRLYVLVMGVSAFTLQPAAHTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWASVSPRINLTWHKNDSA
RTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNASYCDKMSIELRVFENTDAFLPFISYPQILTLSTSGVL
VCPDLSEFTRDKTDVKIQWYKDSLLLDKDNEKFLSVRGTTHLLVHDVALEDAGYYRCVLTFAHEGQQYNITRSIE
LRIKKKKEETIPVIISPLKTISASLGSRLTIPCKVFLGTGTPLTTMLWWTANDTHIESAYPGGRVTEGPRQEYSE
NNENYIEVPLIFDPVTREDLHMDFKCVVHNTLSFQTLRTTVKEASSTFSWGIVLAPLSLAFLVLGGIWMHRRCKH
RTGKADGLTVLWPHHQDFQSYPK
Structural information
Protein Domains
Ig-like (18-124)
Ig-like (134-223)
Ig-like (237-349)
Interpro:  IPR007110  IPR036179  IPR013783  IPR003599  IPR003598  
IPR015621  IPR004074  IPR004077  IPR013151  
Prosite:   PS50835

PDB:  
3O4O
PDBsum:   3O4O

DIP:  

61267

MINT:  
STRING:   ENSP00000330959
Other Databases GeneCards:  IL1R2  Malacards:  IL1R2

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0004908 interleukin-1 receptor ac
tivity
TAS molecular function
GO:0004910 interleukin-1, Type II, b
locking receptor activity
IEA molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005576 extracellular region
IEA cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0006955 immune response
TAS biological process
GO:0016021 integral component of mem
brane
IEA cellular component
GO:0019221 cytokine-mediated signali
ng pathway
IEA biological process
GO:0004908 interleukin-1 receptor ac
tivity
IEA molecular function
GO:0004908 interleukin-1 receptor ac
tivity
TAS molecular function
GO:0004910 interleukin-1, Type II, b
locking receptor activity
IEA molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005576 extracellular region
IEA cellular component
GO:0005576 extracellular region
IEA cellular component
GO:0005886 plasma membrane
IEA cellular component
GO:0005886 plasma membrane
IEA cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0006955 immune response
TAS biological process
GO:0016020 membrane
IEA cellular component
GO:0016021 integral component of mem
brane
IEA cellular component
GO:0019221 cytokine-mediated signali
ng pathway
IEA biological process
GO:0004908 interleukin-1 receptor ac
tivity
TAS molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0006955 immune response
TAS biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04060Cytokine-cytokine receptor interaction
hsa04640Hematopoietic cell lineage
hsa05202Transcriptional misregulation in cancer
hsa05215Prostate cancer
hsa05418Fluid shear stress and atherosclerosis
hsa05166Human T-cell leukemia virus 1 infection
hsa05146Amoebiasis
Associated diseases References
Cancer GAD: 19573080
Cancer (myeloma) GAD: 20568250
Atherosclerosis GAD: 19948975
Thromboembolism GAD: 17413037
Platelet aggregation GAD: 17903294
Hodgkin disease GAD: 19573080
Ankylosing spondylitis GAD: 20062062
Behcet's disease GAD: 20622878
Ulcerative colitis GAD: 21297633
Behcet's disease GAD: 20622878
Ulcerative colitis GAD: 21297633
Periodontitis GAD: 11846196
Bone diseases GAD: 19453261
Degenerative arthropathy GAD: 20353565
Ankylosing spondylitis GAD: 20062062
Alzheimer's disease GAD: 15653174
Endometriosis INFBASE: 25063483
Female infertility INFBASE: 21958553
Endometriosis-associated infertility INFBASE: 17919610
Chorioamnionitis GAD: 20452482
Connective tissue diseases GAD: 19527514
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Cryptorchidism MIK: 28606200
Endometriosis MIK: 25063483
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
25063483 Endometrio
sis



Show abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract