• Gene id: 7837

Gene Summary

• Gene Symbol: PXDN   Gene   UCSC   Ensembl
• Aliases: ASGD7, COPOA, D2S448, D2S448E, MG50, PRG2, PXN, VPO
• Gene name: peroxidasin
• Alternate names: peroxidasin homolog, melanoma-associated antigen MG50, p53-responsive gene 2 protein, vascular peroxidase 1,
• Gene location: 2p25.3 (1744851: 1631886)     Exons: 24     NC_000002.12
• Gene summary(Entrez): This gene encodes a heme-containing peroxidase that is secreted into the extracellular matrix. It is involved in extracellular matrix formation, and may function in the physiological and pathological fibrogenic response in fibrotic kidney. Mutations in th
• OMIM: 611321

Protein Summary

• Protein general information: Q92626  
  • Name: Peroxidasin homolog (EC 1.11.1.7) (Melanoma associated antigen MG50) (Vascular peroxidase 1) (p53 responsive gene 2 protein)
  • Length: 1479  
  • Mass: 165275
  • Tissue specificity: Expressed at higher levels in heart, lung, ovary, spleen, intestine and placenta, and at lower levels in liver, colon, pancreas, kidney, thymus, skeletal muscle and prostate. Expressed in tumors such as melanoma, breast cancer, ovarian
• Sequence:

  MAKRSRGPGRRCLLALVLFCAWGTLAVVAQKPGAGCPSRCLCFRTTVRCMHLLLEAVPAVAPQTSILDLRFNRIR
  EIQPGAFRRLRNLNTLLLNNNQIKRIPSGAFEDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLD
  PDSFQHLPKLERLFLHNNRITHLVPGTFNHLESMKRLRLDSNTLHCDCEILWLADLLKTYAESGNAQAAAICEYP
  RRIQGRSVATITPEELNCERPRITSEPQDADVTSGNTVYFTCRAEGNPKPEIIWLRNNNELSMKTDSRLNLLDDG
  TLMIQNTQETDQGIYQCMAKNVAGEVKTQEVTLRYFGSPARPTFVIQPQNTEVLVGESVTLECSATGHPPPRISW
  TRGDRTPLPVDPRVNITPSGGLYIQNVVQGDSGEYACSATNNIDSVHATAFIIVQALPQFTVTPQDRVVIEGQTV
  DFQCEAKGNPPPVIAWTKGGSQLSVDRRHLVLSSGTLRISGVALHDQGQYECQAVNIIGSQKVVAHLTVQPRVTP
  VFASIPSDTTVEVGANVQLPCSSQGEPEPAITWNKDGVQVTESGKFHISPEGFLTINDVGPADAGRYECVARNTI
  GSASVSMVLSVNVPDVSRNGDPFVATSIVEAIATVDRAINSTRTHLFDSRPRSPNDLLALFRYPRDPYTVEQARA
  GEIFERTLQLIQEHVQHGLMVDLNGTSYHYNDLVSPQYLNLIANLSGCTAHRRVNNCSDMCFHQKYRTHDGTCNN
  LQHPMWGASLTAFERLLKSVYENGFNTPRGINPHRLYNGHALPMPRLVSTTLIGTETVTPDEQFTHMLMQWGQFL
  DHDLDSTVVALSQARFSDGQHCSNVCSNDPPCFSVMIPPNDSRARSGARCMFFVRSSPVCGSGMTSLLMNSVYPR
  EQINQLTSYIDASNVYGSTEHEARSIRDLASHRGLLRQGIVQRSGKPLLPFATGPPTECMRDENESPIPCFLAGD
  HRANEQLGLTSMHTLWFREHNRIATELLKLNPHWDGDTIYYETRKIVGAEIQHITYQHWLPKILGEVGMRTLGEY
  HGYDPGINAGIFNAFATAAFRFGHTLVNPLLYRLDENFQPIAQDHLPLHKAFFSPFRIVNEGGIDPLLRGLFGVA
  GKMRVPSQLLNTELTERLFSMAHTVALDLAAINIQRGRDHGIPPYHDYRVYCNLSAAHTFEDLKNEIKNPEIREK
  LKRLYGSTLNIDLFPALVVEDLVPGSRLGPTLMCLLSTQFKRLRDGDRLWYENPGVFSPAQLTQIKQTSLARILC
  DNADNITRVQSDVFRVAEFPHGYGSCDEIPRVDLRVWQDCCEDCRTRGQFNAFSYHFRGRRSLEFSYQEDKPTKK
  TRPRKIPSVGRQGEHLSNSTSAFSTRSDASGTNDFREFVLEMQKTITDLRTQIKKLESRLSTTECVDAGGESHAN
  NTKWKKDACTICECKDGQVTCFVEACPPATCAVPVNIPGACCPVCLQKRAEEKP

• Structural information:
  • Protein Domains: (27..6-)
    (/note="LRRNT-)
    (192..24-)
    (/note="LRRCT-)
    (246..33-)
    1 (/note="Ig-like-C2-type)
    (342..42-)
    2 (/note="Ig-like-C2-type)
    (433..52-)
    3 (/note="Ig-like-C2-type)
    (521..61-)
    4 (/note="Ig-like-C2-type)
    (1413-)
  • Interpro: IPR000483  IPR019791  IPR010255  IPR037120  IPR007110   IPR036179  IPR013783  IPR013098  IPR003599  IPR003598  IPR001611  IPR003591  IPR032675  IPR034828  IPR034824  IPR001007  
  • Prosite: PS50835 PS51450 PS50292 PS01208 PS50184
  • CDD: cd09826
  • STRING: ENSP00000252804
• Other Databases: GeneCards:  PXDN  Malacards:  PXDN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0004601	peroxidase activity	IBA	molecular function
GO:0004601	peroxidase activity	IEA	molecular function
GO:0020037	heme binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0004601	peroxidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0042744	hydrogen peroxide catabolic process	IEA	biological process
GO:0004601	peroxidase activity	IEA	molecular function
GO:0019806	bromide peroxidase activity	IDA	molecular function
GO:0070831	basement membrane assembly	ISS	biological process
GO:0030199	collagen fibril organization	IMP	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0062023	collagen-containing extracellular matrix	IEA	cellular component
GO:0030198	extracellular matrix organization	IEA	biological process
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0001960	negative regulation of cytokine-mediated signaling pathway	IEA	biological process
GO:0042744	hydrogen peroxide catabolic process	IDA	biological process
GO:0030198	extracellular matrix organization	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005201	extracellular matrix structural constituent	IDA	molecular function
GO:0004601	peroxidase activity	IDA	molecular function
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0062023	collagen-containing extracellular matrix	IDA	cellular component
GO:0020037	heme binding	IDA	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0004601	peroxidase activity	IDA	molecular function
GO:0006955	immune response	NAS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005152	interleukin-1 receptor antagonist activity	NAS	molecular function

Diseases

Associated diseases	References
Anterior segment dysgenesis	KEGG:H01159
Anterior segment dysgenesis	KEGG:H01159
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray