• Gene id: 7832

Gene Summary

• Gene Symbol: BTG2   Gene   UCSC   Ensembl
• Aliases: APRO1, PC3, TIS21
• Gene name: BTG anti-proliferation factor 2
• Alternate names: protein BTG2, B-cell translocation gene 2, BTG family member 2, NGF-inducible anti-proliferative protein PC3, nerve growth factor-inducible anti-proliferative, pheochromacytoma cell-3,
• Gene location: 1q32.1 (203305518: 203309601)     Exons: 2     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein is involved in the regulation of the G1/S transition of the cell cycle
• OMIM: 601597

Protein Summary

• Protein general information: P78543  
  • Name: Protein BTG2 (BTG family member 2) (NGF inducible anti proliferative protein PC3)
  • Length: 158  
  • Mass: 17416
• Sequence:

  MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMD
  PIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLGRSSPSK
  NYVMAVSS

• Structural information:
  • Interpro: IPR002087  IPR036054  IPR033328  
  • Prosite: PS00960 PS01203
  • PDB: 3DJU 3E9V
  • PDBsum: 3DJU 3E9V
  • STRING: ENSP00000290551
• Other Databases: GeneCards:  BTG2  Malacards:  BTG2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008285	negative regulation of cell population proliferation	IBA	biological process
GO:0045930	negative regulation of mitotic cell cycle	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0017148	negative regulation of translation	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IMP	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0006281	DNA repair	TAS	biological process
GO:0060213	positive regulation of nuclear-transcribed mRNA poly(A) tail shortening	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0035914	skeletal muscle cell differentiation	IEA	biological process
GO:0021954	central nervous system neuron development	IEA	biological process
GO:0008306	associative learning	IEA	biological process
GO:0051602	response to electrical stimulus	IEA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0043434	response to peptide hormone	IEA	biological process
GO:0030182	neuron differentiation	IEA	biological process
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:2000178	negative regulation of neural precursor cell proliferation	IEA	biological process
GO:0021542	dentate gyrus development	IEA	biological process
GO:0009952	anterior/posterior pattern specification	IEA	biological process
GO:0006479	protein methylation	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0010243	response to organonitrogen compound	IEA	biological process
GO:0010033	response to organic substance	IEA	biological process
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0031175	neuron projection development	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation

Diseases

Associated diseases	References
Breast cancer	PMID:16849553
Brain ischemia	PMID:7684483
renal cell carcinoma	PMID:14996721
prostate carcinoma in situ	PMID:11470758
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospadias	MIK: 24778562
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
24778562	Hypospadias			13 (5 controls, 8 cases)	Male infertility	Microarray