• Gene id: 7818

Gene Summary

• Gene Symbol: DAP3   Gene   UCSC   Ensembl
• Aliases: DAP-3, MRP-S29, MRPS29, S29mt, bMRP-10
• Gene name: death associated protein 3
• Alternate names: 28S ribosomal protein S29, mitochondrial, ionizing radiation resistance conferring protein, mitochondrial 28S ribosomal protein S29, mitochondrial small ribosomal subunit protein mS29,
• Gene location: 1q22 (155687901: 155739009)     Exons: 15     NC_000001.11
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 602074

Protein Summary

• Protein general information: P51398  
  • Name: 28S ribosomal protein S29, mitochondrial (MRP S29) (S29mt) (Death associated protein 3) (DAP 3) (Ionizing radiation resistance conferring protein) (Mitochondrial small ribosomal subunit protein mS29)
  • Length: 398  
  • Mass: 45566
  • Tissue specificity: Ubiquitous.
• Sequence:

  MMLKGITRLISRIHKLDPGRFLHMGTQARQSIAAHLDNQVPVESPRAISRTNENDPAKHGDQHEGQHYNISPQDL
  ETVFPHGLPPRFVMQVKTFSEACLMVRKPALELLHYLKNTSFAYPAIRYLLYGEKGTGKTLSLCHVIHFCAKQDW
  LILHIPDAHLWVKNCRDLLQSSYNKQRFDQPLEASTWLKNFKTTNERFLNQIKVQEKYVWNKRESTEKGSPLGEV
  VEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKSPIAPEELALVHNLRKMMKND
  WHGGAIVSALSQTGSLFKPRKAYLPQELLGKEGFDALDPFIPILVSNYNPKEFESCIQYYLENNWLQHEKAPTEE
  GKKELLFLSNANPSLLERHCAYL

• Structural information:
  • Interpro: IPR027417  IPR019368  IPR008092  
  • PDB: 3J9M 6NU2 6NU3
  • PDBsum: 3J9M 6NU2 6NU3
  • STRING: ENSP00000357320
• Other Databases: GeneCards:  DAP3  Malacards:  DAP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005763	mitochondrial small ribosomal subunit	IBA	cellular component
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0005739	mitochondrion	IDA	cellular component
GO:0005763	mitochondrial small ribosomal subunit	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005761	mitochondrial ribosome	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0015935	small ribosomal subunit	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)