• Gene id: 7803

Gene Summary

• Gene Symbol: PTP4A1   Gene   UCSC   Ensembl
• Aliases: HH72, PRL-1, PRL1, PTP(CAAX1), PTPCAAX1
• Gene name: protein tyrosine phosphatase 4A1
• Alternate names: protein tyrosine phosphatase type IVA 1, PVT1/PTP4A1 fusion, phosphatase of regenerating liver 1, protein tyrosine phosphatase type IVA protein 1, protein tyrosine phosphatase type IVA, member 1, protein-tyrosine phosphatase of regenerating liver 1,
• Gene location: 6q12 (10302123: 10427616)     Exons: 17     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of a small class of prenylated protein tyrosine phosphatases (PTPs), which contain a PTP domain and a characteristic C-terminal prenylation motif. The encoded protein is a cell signaling molecule that plays regulatory roles in a
• OMIM: 601585

Protein Summary

• Protein general information: Q93096  
  • Name: Protein tyrosine phosphatase type IVA 1 (EC 3.1.3.48) (PTP(CAAXI)) (Protein tyrosine phosphatase 4a1) (Protein tyrosine phosphatase of regenerating liver 1) (PRL 1)
  • Length: 173  
  • Mass: 19815
  • Tissue specificity: Expressed in bone marrow, lymph nodes, T lymphocytes, spleen, thymus and tonsil. Overexpressed in tumor cell lines. {ECO
• Sequence:

  MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAP
  PSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLE
  KYRPKMRLRFKDSNGHRNNCCIQ

• Structural information:
  • Protein Domains: (82..14-)
    (/note="Tyrosine-protein-phosphatase")
  • Interpro: IPR000340  IPR029021  IPR003595  IPR000387  
  • Prosite: PS50056
  • PDB: 1RXD 1XM2 5BX1
  • PDBsum: 1RXD 1XM2 5BX1
  • STRING: ENSP00000359685
• Other Databases: GeneCards:  PTP4A1  Malacards:  PTP4A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030335	positive regulation of cell migration	IBA	biological process
GO:0004725	protein tyrosine phosphatase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0016311	dephosphorylation	IEA	biological process
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0009898	cytoplasmic side of plasma membrane	IDA	cellular component
GO:0004725	protein tyrosine phosphatase activity	NAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male infertility	MIK: 18367176
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
18367176	Male infertility				Male infertility	Microarray