• Gene id: 7791

Gene Summary

• Gene Symbol: ZYX   Gene   UCSC   Ensembl
• Aliases: ESP-2, HED-2
• Gene name: zyxin
• Alternate names: zyxin, zyxin-2,
• Gene location: 7q34 (143381344: 143391110)     Exons: 10     NC_000007.14
• Gene summary(Entrez): Focal adhesions are actin-rich structures that enable cells to adhere to the extracellular matrix and at which protein complexes involved in signal transduction assemble. Zyxin is a zinc-binding phosphoprotein that concentrates at focal adhesions and alon

Protein Summary

• Protein general information: Q15942  
  • Name: Zyxin (Zyxin 2)
  • Length: 572  
  • Mass: 61277
• Sequence:

  MAAPRPSPAISVSVSAPAFYAPQKKFGPVVAPKPKVNPFRPGDSEPPPAPGAQRAQMGRVGEIPPPPPEDFPLPP
  PPLAGDGDDAEGALGGAFPPPPPPIEESFPPAPLEEEIFPSPPPPPEEEGGPEAPIPPPPQPREKVSSIDLEIDS
  LSSLLDDMTKNDPFKARVSSGYVPPPVATPFSSKSSTKPAAGGTAPLPPWKSPSSSQPLPQVPAPAQSQTQFHVQ
  PQPQPKPQVQLHVQSQTQPVSLANTQPRGPPASSPAPAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPE
  ALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELEQLTQQLMQDMEHPQR
  QNVAVNELCGRCHQPLARAQPAVRALGQLFHIACFTCHQCAQQLQGQQFYSLEGAPYCEGCYTDTLEKCNTCGEP
  ITDRMLRATGKAYHPHCFTCVVCARPLEGTSFIVDQANRPHCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVA
  LDKNFHMKCYKCEDCGKPLSIEADDNGCFPLDGHVLCRKCHTARAQT

• Structural information:
  • Protein Domains: (384..44-)
    1 (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125-)
    (444..50-)
    2 (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125-)
    (504..57-)
    3 (/note="LIM-zinc-binding)
    (/evidence="ECO-)
  • Interpro: IPR001781  
  • Prosite: PS00478 PS50023
  • STRING: ENSP00000324422
• Other Databases: GeneCards:  ZYX  Malacards:  ZYX

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007229	integrin-mediated signaling pathway	IBA	biological process
GO:0007165	signal transduction	IBA	biological process
GO:0007179	transforming growth factor beta receptor signaling pathway	IBA	biological process
GO:0005925	focal adhesion	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0001725	stress fiber	IBA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005912	adherens junction	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050727	regulation of inflammatory response	IEA	biological process
GO:0007160	cell-matrix adhesion	IEA	biological process
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0071346	cellular response to interferon-gamma	IEA	biological process
GO:0005925	focal adhesion	IEA	cellular component
GO:0007179	transforming growth factor beta receptor signaling pathway	IEA	biological process
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0001725	stress fiber	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0001725	stress fiber	IDA	cellular component
GO:0007160	cell-matrix adhesion	IC	biological process
GO:0005925	focal adhesion	IDA	cellular component
GO:0007229	integrin-mediated signaling pathway	IMP	biological process
GO:0043149	stress fiber assembly	IMP	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0005925	focal adhesion	HDA	cellular component
GO:0007179	transforming growth factor beta receptor signaling pathway	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04510	Focal adhesion

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray