• Gene id: 7784

Gene Summary

• Gene Symbol: ZP3   Gene   UCSC   Ensembl
• Aliases: OOMD3, ZP3A, ZP3B, ZPC, Zp-3
• Gene name: zona pellucida glycoprotein 3
• Alternate names: zona pellucida sperm-binding protein 3, ZP3A/ZP3B, sperm receptor, zona pellucida glycoprotein 3B, zona pellucida glycoprotein ZP3, zona pellucida protein C,
• Gene location: 7q11.23 (76397521: 76442068)     Exons: 9     NC_000007.14
• Gene summary(Entrez): The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. The protein encoded by this gene
• OMIM: 182889

Protein Summary

• Protein general information: P21754  
  • Name: Zona pellucida sperm binding protein 3 (Sperm receptor) (ZP3A/ZP3B) (Zona pellucida glycoprotein 3) (Zp 3) (Zona pellucida protein C) [Cleaved into: Processed zona pellucida sperm binding protein 3]
  • Length: 424  
  • Mass: 47018
  • Tissue specificity: Expressed in oocytes (at protein level). {ECO
• Sequence:

  MELSYRLFICLLLWGSTELCYPQPLWLLQGGASHPETSVQPVLVECQEATLMVMVSKDLFGTGKLIRAADLTLGP
  EACEPLVSMDTEDVVRFEVGLHECGNSMQVTDDALVYSTFLLHDPRPVGNLSIVRTNRAEIPIECRYPRQGNVSS
  QAILPTWLPFRTTVFSEEKLTFSLRLMEENWNAEKRSPTFHLGDAAHLQAEIHTGSHVPLRLFVDHCVATPTPDQ
  NASPYHTIVDFHGCLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNMIYITCHLKVTLAEQDPDELNKAC
  SFSKPSNSWFPVEGSADICQCCNKGDCGTPSHSRRQPHVMSQWSRSASRNRRHVTEEADVTVGPLIFLDRRGDHE
  VEQWALPSDTSVVLLGVGLAVVVSLTLTAVILVLTRRCRTASHPVSASE

• Structural information:
  • Protein Domains: (45..30-)
    (/note="ZP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00375"-)
  • Interpro: IPR040196  IPR001507  IPR017977  
  • Prosite: PS00682 PS51034
  • STRING: ENSP00000378326
• Other Databases: GeneCards:  ZP3  Malacards:  ZP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031012	extracellular matrix	IBA	cellular component
GO:0032190	acrosin binding	IBA	molecular function
GO:0007339	binding of sperm to zona pellucida	IBA	biological process
GO:0035803	egg coat formation	IBA	biological process
GO:2000344	positive regulation of acrosome reaction	IBA	biological process
GO:0035805	egg coat	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0007339	binding of sperm to zona pellucida	IEA	biological process
GO:0035803	egg coat formation	IEA	biological process
GO:0035804	structural constituent of egg coat	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0007338	single fertilization	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007339	binding of sperm to zona pellucida	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005201	extracellular matrix structural constituent	HDA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000368	positive regulation of acrosomal vesicle exocytosis	IDA	biological process
GO:0062023	collagen-containing extracellular matrix	IDA	cellular component
GO:2000344	positive regulation of acrosome reaction	IDA	biological process
GO:2000344	positive regulation of acrosome reaction	IDA	biological process
GO:0007339	binding of sperm to zona pellucida	IDA	biological process
GO:2000360	negative regulation of binding of sperm to zona pellucida	IDA	biological process
GO:2000344	positive regulation of acrosome reaction	IDA	biological process
GO:0030246	carbohydrate binding	IDA	molecular function
GO:0007339	binding of sperm to zona pellucida	IDA	biological process
GO:0002922	positive regulation of humoral immune response	IDA	biological process
GO:2000368	positive regulation of acrosomal vesicle exocytosis	IMP	biological process
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0032753	positive regulation of interleukin-4 production	ISS	biological process
GO:0005615	extracellular space	IMP	cellular component
GO:0001825	blastocyst formation	ISS	biological process
GO:0001809	positive regulation of type IV hypersensitivity	ISS	biological process
GO:0035803	egg coat formation	ISS	biological process
GO:0010513	positive regulation of phosphatidylinositol biosynthetic process	ISS	biological process
GO:0007339	binding of sperm to zona pellucida	IGI	biological process
GO:0007339	binding of sperm to zona pellucida	IMP	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002687	positive regulation of leukocyte migration	ISS	biological process
GO:2000388	positive regulation of antral ovarian follicle growth	ISS	biological process
GO:0050729	positive regulation of inflammatory response	ISS	biological process
GO:0048599	oocyte development	ISS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	ISS	biological process
GO:0032190	acrosin binding	IPI	molecular function
GO:2000386	positive regulation of ovarian follicle development	ISS	biological process
GO:0048018	receptor ligand activity	ISS	molecular function
GO:0048015	phosphatidylinositol-mediated signaling	ISS	biological process
GO:0042102	positive regulation of T cell proliferation	ISS	biological process
GO:0032729	positive regulation of interferon-gamma production	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002455	humoral immune response mediated by circulating immunoglobulin	ISS	biological process

Diseases

Associated diseases	References
Oocyte defects	INFBASE: 8557130
Oocyte maturation	INFBASE: 15860499
Induced the sperm acrosome reaction in vitro	MIK: 7819440
Fertilizing defects	INFBASE: 8557130
Fertilizing defects	INFBASE: 15860499
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq