About Us

Search Result


Gene id 7782
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol SLC30A4   Gene   UCSC   Ensembl
Aliases ZNT4, znT-4
Gene name solute carrier family 30 member 4
Alternate names zinc transporter 4, solute carrier family 30 (zinc transporter), member 4,
Gene location 15q21.1 (45523754: 45479605)     Exons: 11     NC_000015.10
Gene summary(Entrez) Zinc is the second most abundant trace metal in the human body. It is an essential element, serving both a structural role, as in the formation of zinc fingers in DNA-binding proteins, and a catalytic role in metalloenzymes, such as pancreatic carboxypept
OMIM 179605

Protein Summary

Protein general information O14863  

Name: Zinc transporter 4 (ZnT 4) (Solute carrier family 30 member 4)

Length: 429  Mass: 47483

Sequence MAGSGAWKRLKSMLRKDDAPLFLNDTSAFDFSDEAGDEGLSRFNKLRVVVADDGSEAPERPVNGAHPTLQADDDS
LLDQDLPLTNSQLSLKVDSCDNCSKQREILKQRKVKARLTIAAVLYLLFMIGELVGGYIANSLAIMTDALHMLTD
LSAIILTLLALWLSSKSPTKRFTFGFHRLEVLSAMISVLLVYILMGFLLYEAVQRTIHMNYEINGDIMLITAAVG
VAVNVIMGFLLNQSGHRHSHSHSLPSNSPTRGSGCERNHGQDSLAVRAAFVHALGDLVQSVGVLIAAYIIRFKPE
YKIADPICTYVFSLLVAFTTFRIIWDTVVIILEGVPSHLNVDYIKEALMKIEDVYSVEDLNIWSLTSGKSTAIVH
IQLIPGSSSKWEEVQSKANHLLLNTFGMYRCTIQLQSYRQEVDRTCANCQSSSP
Structural information
Interpro:  IPR002524  IPR036837  IPR027469  
STRING:   ENSP00000261867
Other Databases GeneCards:  SLC30A4  Malacards:  SLC30A4

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0010043 response to zinc ion
IBA biological process
GO:0061088 regulation of sequesterin
g of zinc ion
IBA biological process
GO:0071577 zinc ion transmembrane tr
ansport
IBA biological process
GO:0005385 zinc ion transmembrane tr
ansporter activity
IBA molecular function
GO:0005886 plasma membrane
IBA cellular component
GO:0006812 cation transport
IEA biological process
GO:0008324 cation transmembrane tran
sporter activity
IEA molecular function
GO:0016021 integral component of mem
brane
IEA cellular component
GO:0055085 transmembrane transport
IEA biological process
GO:0005764 lysosome
IEA cellular component
GO:0005768 endosome
IEA cellular component
GO:0006811 ion transport
IEA biological process
GO:0006829 zinc ion transport
IEA biological process
GO:0016021 integral component of mem
brane
IEA cellular component
GO:0016020 membrane
IEA cellular component
GO:0005385 zinc ion transmembrane tr
ansporter activity
TAS molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0055069 zinc ion homeostasis
IEA biological process
GO:0061088 regulation of sequesterin
g of zinc ion
IDA biological process
GO:0005737 cytoplasm
IDA cellular component
GO:0005770 late endosome
IDA cellular component
GO:0031902 late endosome membrane
IEA cellular component
GO:0005765 lysosomal membrane
IEA cellular component
GO:0010008 endosome membrane
IEA cellular component
GO:0009636 response to toxic substan
ce
IDA biological process
Associated diseases References
prostate carcinoma in situ PMID:12955079
Spermatogenic defects MIK: 31037746
Unexplained infertility MIK: 25753583

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
31037746 Spermatoge
nic defect
s

16 (1 control,
15 cases)
Male infertility GSE6023 analyzed using GEO2R
Show abstract
25753583 Unexplaine
d infertil
ity

46 (17 fertile
men, 29 male pa
tients)
Male infertility Microarray
Show abstract