• Gene id: 7781

Gene Summary

• Gene Symbol: SLC30A3   Gene   UCSC   Ensembl
• Aliases: ZNT3
• Gene name: solute carrier family 30 member 3
• Alternate names: zinc transporter 3, solute carrier family 30 (zinc transporter), member 3, zinc transporter ZnT-3, znT-3,
• Gene location: 2p23.3 (27275862: 27253683)     Exons: 12     NC_000002.12
• OMIM: 605237

Protein Summary

• Protein general information: Q99726  
  • Name: Zinc transporter 3 (ZnT 3) (Solute carrier family 30 member 3)
  • Length: 388  
  • Mass: 41945
• Sequence:

  MEPSPAAGGLETTRLVSPRDRGGAGGSLRLKSLFTEPSEPLPEESKPVEMPFHHCHRDPLPPPGLTPERLHARRQ
  LYAACAVCFVFMAGEVVGGYLAHSLAIMTDAAHLLADVGSMMGSLFSLWLSTRPATRTMTFGWHRSETLGALASV
  VSLWMVTGILLYLAFVRLLHSDYHIEGGAMLLTASIAVCANLLMAFVLHQAGPPHSHGSRGAEYAPLEEGPEEPL
  PLGNTSVRAAFVHVLGDLLQSFGVLAASILIYFKPQYKAADPISTFLFSICALGSTAPTLRDVLRILMEGTPRNV
  GFEPVRDTLLSVPGVRATHELHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLYSRFGFSSCTLQVEQYQPE
  MAQCLRCQEPPQA

• Structural information:
  • Interpro: IPR002524  IPR036837  IPR027469  
  • STRING: ENSP00000233535
• Other Databases: GeneCards:  SLC30A3  Malacards:  SLC30A3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0005385	zinc ion transmembrane transporter activity	IBA	molecular function
GO:0010043	response to zinc ion	IBA	biological process
GO:0061088	regulation of sequestering of zinc ion	IBA	biological process
GO:0071577	zinc ion transmembrane transport	IBA	biological process
GO:0008021	synaptic vesicle	IDA	cellular component
GO:0006812	cation transport	IEA	biological process
GO:0008324	cation transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0006829	zinc ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0015633	ATPase-coupled zinc transmembrane transporter activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0008021	synaptic vesicle	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0099180	zinc ion import into synaptic vesicle	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0030285	integral component of synaptic vesicle membrane	IEA	cellular component
GO:0098686	hippocampal mossy fiber to CA3 synapse	IEA	cellular component
GO:0051050	positive regulation of transport	IEA	biological process
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0061088	regulation of sequestering of zinc ion	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0043005	neuron projection	ISS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881