• Gene id: 7779

Gene Summary

• Gene Symbol: SLC30A1   Gene   UCSC   Ensembl
• Aliases: ZNT1, ZRC1
• Gene name: solute carrier family 30 member 1
• Alternate names: zinc transporter 1, solute carrier family 30 (zinc transporter), member 1, znT-1,
• Gene location: 1q32.3 (211579160: 211571567)     Exons: 10     NC_000001.11
• OMIM: 609521

Protein Summary

• Protein general information: Q9Y6M5  
  • Name: Zinc transporter 1 (ZnT 1) (Solute carrier family 30 member 1)
  • Length: 507  
  • Mass: 55300
• Sequence:

  MGCWGRNRGRLLCMLALTFMFMVLEVVVSRVTSSLAMLSDSFHMLSDVLALVVALVAERFARRTHATQKNTFGWI
  RAEVMGALVNAIFLTGLCFAILLEAIERFIEPHEMQQPLVVLGVGVAGLLVNVLGLCLFHHHSGFSQDSGHGHSH
  GGHGHGHGLPKGPRVKSTRPGSSDINVAPGEQGPDQEETNTLVANTSNSNGLKLDPADPENPRSGDTVEVQVNGN
  LVREPDHMELEEDRAGQLNMRGVFLHVLGDALGSVIVVVNALVFYFSWKGCSEGDFCVNPCFPDPCKAFVEIINS
  THASVYEAGPCWVLYLDPTLCVVMVCILLYTTYPLLKESALILLQTVPKQIDIRNLIKELRNVEGVEEVHELHVW
  QLAGSRIIATAHIKCEDPTSYMEVAKTIKDVFHNHGIHATTIQPEFASVGSKSSVVPCELACRTQCALKQCCGTL
  PQAPSGKDAEKTPAVSISCLELSNNLEKKPRRTKAENIPAVVIEIKNMPNKQPESSL

• Structural information:
  • Interpro: IPR002524  IPR036837  IPR027469  
  • STRING: ENSP00000355968
• Other Databases: GeneCards:  SLC30A1  Malacards:  SLC30A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071577	zinc ion transmembrane transport	IBA	biological process
GO:0019855	calcium channel inhibitor activity	IBA	molecular function
GO:0006882	cellular zinc ion homeostasis	IBA	biological process
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005385	zinc ion transmembrane transporter activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0006812	cation transport	IEA	biological process
GO:0008324	cation transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006829	zinc ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005385	zinc ion transmembrane transporter activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0071585	detoxification of cadmium ion	IEA	biological process
GO:0070509	calcium ion import	IEA	biological process
GO:0030315	T-tubule	IEA	cellular component
GO:0019855	calcium channel inhibitor activity	IEA	molecular function
GO:0005385	zinc ion transmembrane transporter activity	IEA	molecular function
GO:0019855	calcium channel inhibitor activity	IEA	molecular function
GO:0006882	cellular zinc ion homeostasis	IEA	biological process
GO:0006874	cellular calcium ion homeostasis	IEA	biological process
GO:0099061	integral component of postsynaptic density membrane	IEA	cellular component
GO:0070574	cadmium ion transmembrane transport	IEA	biological process
GO:0046929	negative regulation of neurotransmitter secretion	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006829	zinc ion transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0090281	negative regulation of calcium ion import	IEA	biological process
GO:0071584	negative regulation of zinc ion transmembrane import	IEA	biological process
GO:0006829	zinc ion transport	IEA	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0019855	calcium channel inhibitor activity	ISS	molecular function
GO:0019855	calcium channel inhibitor activity	ISS	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0006874	cellular calcium ion homeostasis	ISS	biological process
GO:0006882	cellular zinc ion homeostasis	ISS	biological process
GO:0030315	T-tubule	ISS	cellular component
GO:0006829	zinc ion transport	ISS	biological process
GO:0046929	negative regulation of neurotransmitter secretion	ISS	biological process
GO:0070574	cadmium ion transmembrane transport	ISS	biological process
GO:0071584	negative regulation of zinc ion transmembrane import	ISS	biological process
GO:0090281	negative regulation of calcium ion import	ISS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04978	Mineral absorption

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray