• Gene id: 7767

Gene Summary

• Gene Symbol: ZNF224   Gene   UCSC   Ensembl
• Aliases: BMZF-2, BMZF2, KOX22, ZNF233, ZNF255, ZNF27
• Gene name: zinc finger protein 224
• Alternate names: zinc finger protein 224, bone marrow zinc finger 2, zinc finger protein 233, zinc finger protein 255, zinc finger protein 27, zinc finger protein KOX22,
• Gene location: 19q13.31 (44094349: 44109885)     Exons: 13     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the Krueppel C2H2-type zinc-finger family of proteins. The encoded protein represses transcription of the aldolase A gene, which encodes a key enzyme in glycolysis. The encoded zinc-finger protein may also function as a trans
• OMIM: 194555

Protein Summary

• Protein general information: Q9NZL3  
  • Name: Zinc finger protein 224 (Bone marrow zinc finger 2) (BMZF 2) (Zinc finger protein 233) (Zinc finger protein 255) (Zinc finger protein 27) (Zinc finger protein KOX22)
  • Length: 707  
  • Mass: 82280
  • Tissue specificity: Ubiquitous. Mainly expressed in fetal tissues. {ECO
• Sequence:

  MTTFKEAMTFKDVAVVFTEEELGLLDLAQRKLYRDVMLENFRNLLSVGHQAFHRDTFHFLREEKIWMMKTAIQRE
  GNSGDKIQTEMETVSEAGTHQEWSFQQIWEKIASDLTRSQDLMINSSQFSKEGDFPCQTEAGLSVIHTRQKSSQG
  NGYKPSFSDVSHFDFHQQLHSGEKSHTCDECGKNFCYISALRIHQRVHMGEKCYKCDVCGKEFSQSSHLQTHQRV
  HTGEKPFKCVECGKGFSRRSALNVHHKLHTGEKPYNCEECGKAFIHDSQLQEHQRIHTGEKPFKCDICGKSFCGR
  SRLNRHSMVHTAEKPFRCDTCDKSFRQRSALNSHRMIHTGEKPYKCEECGKGFICRRDLYTHHMVHTGEKPYNCK
  ECGKSFRWASCLLKHQRVHSGEKPFKCEECGKGFYTNSQCYSHQRSHSGEKPYKCVECGKGYKRRLDLDFHQRVH
  TGEKLYNCKECGKSFSRAPCLLKHERLHSGEKPFQCEECGKRFTQNSHLHSHQRVHTGEKPYKCEKCGKGYNSKF
  NLDMHQKVHTGERPYNCKECGKSFGWASCLLKHQRLHSGEKPFKCEECGKRFTQNSQLHSHQRVHTGEKPYKCDE
  CGKGFSWSSTRLTHQRRHSRETPLKCEQHGKNIVQNSFSKVQEKVHSVEKPYKCEDCGKGYNRRLNLDMHQRVHM
  GEKTWKCRECDMCFSQASSLRLHQNVHVGEKP

• Structural information:
  • Protein Domains: (8..7-)
    (/note="KRAB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00119"-)
  • Interpro: IPR001909  IPR036051  IPR036236  IPR013087  
  • Prosite: PS50805 PS00028 PS50157
  • CDD: cd07765
  • PDB: 2ELY 2ELZ 2EM0 2EM6 2EM7 2EM8 2EM9 2EN1 2EN8 2ENA 2ENC 2EOQ 2EOR 2EQ4 2YSP 2YTH
  • PDBsum: 2ELY 2ELZ 2EM0 2EM6 2EM7 2EM8 2EM9 2EN1 2EN8 2ENA 2ENC 2EOQ 2EOR 2EQ4 2YSP 2YTH
  • STRING: ENSP00000337368
• Other Databases: GeneCards:  ZNF224  Malacards:  ZNF224

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0017053	transcription repressor complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)