• Gene id: 7762

Gene Summary

• Gene Symbol: ZNF215   Gene   UCSC   Ensembl
• Aliases: BAZ-2, BAZ2, ZKSCAN11, ZSCAN43
• Gene name: zinc finger protein 215
• Alternate names: zinc finger protein 215, BWSCR2-associated zinc finger protein 2, zinc finger protein with KRAB and SCAN domains 11,
• Gene location: 11p15.4 (6926425: 6991143)     Exons: 10     NC_000011.10
• Gene summary(Entrez): This gene is imprinted in a tissue-specific manner with preferential expression in the testis, and encodes a zinc finger protein that belongs to a family of zinc finger transcription factors. The encoded protein contains an N-terminal SRE-ZBP, Ctfin51, AW

SNPs

rs28362491

Strand:    Allele origin:   Allele change:   Mutation type: delins

NC_000004.12   g.102500998_102501001ATTG[1]
NC_000004.11   g.103422155_103422158ATTG[1]
NG_050628.1   g.4670_4673ATTG[1]|SEQ=[ATTG/-]|GENE=NFKB1
LOC105377621   105377621

Protein Summary

• Protein general information: Q9UL58  
  • Name: Zinc finger protein 215 (BWSCR2 associated zinc finger protein 2) (BAZ 2) (Zinc finger protein with KRAB and SCAN domains 11)
  • Length: 517  
  • Mass: 60034
• Sequence:

  MQPLSKLMAISKPRNLSLREQREVLRADMSWQQETNPVVETHDSEASRQKFRHFQYLKVSGPHEALSQLWELCLQ
  WLRPEIHTKKQIIELLVLEQFLAILPEEVRTWVNLQHPNNSKDMVTLIEDVIEMLEDEDMPCKDSALQMGSIKEK
  MKAGSRTGKPQEPVTFKDVVVEFSKEEWGQLDSAVKNLYRNVMLENFRNLNSLRKAHLLSKPFESLKLESKKKRW
  IMEKEIPRKTIFDMKSISGEESSHGVIMTRLTESGHPSSDAWKGENWLYRNQKKWDINLPQEAFIPETIYTEEED
  FECSENKKSFDINSVSSICAIQVGIPSRKGSPKCDKFKTYFKFNLDSVGKQHSEYEYGNDLSLSTDIRHQKSHTT
  MNSYECYQCGKAFCRSSSLIRHQIIHTGEKPYKCSECGRFFNRRTNLTKHQKLHAEAKACTSNKCGKAFSKSEDS
  NNPTLHFGNNFYQCVNCGKSFNRSSSLIRHQMIHTGEKPFKCKECSKAFNRSSNLVKHQKLHTRDKS

• Structural information:
  • Protein Domains: (48..12-)
    (/note="SCAN-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00187-)
    (164..23-)
    (/note="KRAB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00119"-)
  • Interpro: IPR001909  IPR036051  IPR003309  IPR038269  IPR036236   IPR013087  
  • Prosite: PS50805 PS50804 PS00028 PS50157
  • CDD: cd07765 cd07936
  • STRING: ENSP00000278319
• Other Databases: GeneCards:  ZNF215  Malacards:  ZNF215

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042552	myelination	IBA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IBA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003700	DNA-binding transcription factor activity	NAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881