• Gene id: 7756

Gene Summary

• Gene Symbol: ZNF207   Gene   UCSC   Ensembl
• Aliases: BuGZ, hBuGZ
• Gene name: zinc finger protein 207
• Alternate names: BUB3-interacting and GLEBS motif-containing protein ZNF207,
• Gene location: 17q11.2 (32350137: 32381884)     Exons: 14     NC_000017.11
• OMIM: 603428

Protein Summary

• Protein general information: O43670  
  • Name: BUB3 interacting and GLEBS motif containing protein ZNF207 (BuGZ) (hBuGZ) (Zinc finger protein 207)
  • Length: 478  
  • Mass: 50751
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDI
  ELEIYGMEGIPEKDMDERRRLLEQKTQESQKKKQQDDSDEYDDDDSAASTSFQPQPVQPQQGYIPPMAQPGLPPV
  PGAPGMPPGIPPLMPGVPPLMPGMPPVMPGMPPGMMPMGGMMPPGPGIPPLMPGMPPGMPPPVPRPGIPPMTQAQ
  AVSAPGILNRPPAPTATVPAPQPPVTKPLFPSAGQMGTPVTSSSTASSNSESLSASSKALFPSTAQAQAAVQGPV
  GTDFKPLNSTPATTTEPPKPTFPAYTQSTASTTSTTNSTAAKPAASITSKPATLTTTSATSKLIHPDEDISLEER
  RAQLPKYQRNLPRPGQAPIGNPPVGPIGGMMPPQPGIPQQQGMRPPMPPHGQYGGHHQGMPGYLPGAMPPYGQGP
  PMVPPYQGGPPRPPMGMRPPVMSQGGRY

• Structural information:
  • Interpro: IPR013087  
  • Prosite: PS00028
  • STRING: ENSP00000378165
• Other Databases: GeneCards:  ZNF207  Malacards:  ZNF207

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000776	kinetochore	IBA	cellular component
GO:0008017	microtubule binding	IBA	molecular function
GO:0090307	mitotic spindle assembly	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0007094	mitotic spindle assembly checkpoint	IBA	biological process
GO:0008608	attachment of spindle microtubules to kinetochore	IBA	biological process
GO:1990047	spindle matrix	IBA	cellular component
GO:0008017	microtubule binding	IDA	molecular function
GO:0000776	kinetochore	IDA	cellular component
GO:0090307	mitotic spindle assembly	IDA	biological process
GO:0008017	microtubule binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:1990047	spindle matrix	IDA	cellular component
GO:0050821	protein stabilization	IMP	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0000776	kinetochore	IMP	cellular component
GO:0051983	regulation of chromosome segregation	IMP	biological process
GO:0051983	regulation of chromosome segregation	IMP	biological process
GO:0008608	attachment of spindle microtubules to kinetochore	IMP	biological process
GO:0008608	attachment of spindle microtubules to kinetochore	IMP	biological process
GO:0007094	mitotic spindle assembly checkpoint	IMP	biological process
GO:0007094	mitotic spindle assembly checkpoint	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000070	mitotic sister chromatid segregation	IMP	biological process
GO:0000070	mitotic sister chromatid segregation	IMP	biological process
GO:0046785	microtubule polymerization	ISS	biological process
GO:0001578	microtubule bundle formation	ISS	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0007059	chromosome segregation	IEA	biological process
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0090307	mitotic spindle assembly	IEA	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0008201	heparin binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003700	DNA-binding transcription factor activity	NAS	molecular function
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process
GO:0005634	nucleus	NAS	cellular component
GO:0008270	zinc ion binding	NAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881