• Gene id: 7746

Gene Summary

• Gene Symbol: ZSCAN9   Gene   UCSC   Ensembl
• Aliases: PRD51, ZNF193
• Gene name: zinc finger and SCAN domain containing 9
• Alternate names: zinc finger and SCAN domain-containing protein 9, cell proliferation-inducing gene 12 protein, cell proliferation-inducing protein 12, zinc finger protein 193,
• Gene location: 6p22.1 (28224701: 28233486)     Exons: 7     NC_000006.12

Protein Summary

• Protein general information: O15535  
  • Name: Zinc finger and SCAN domain containing protein 9 (Cell proliferation inducing gene 12 protein) (PRD51) (Zinc finger protein 193)
  • Length: 394  
  • Mass: 45954
• Sequence:

  MNTNSKEVLSLGVQVPEAWEELLTMKVEAKSHLQWQESRLKRSNPLAREIFRRHFRQLCYQETPGPREALTRLQE
  LCYQWLRPHVSTKEQILDLLVLEQFLSILPKELQGWVREHCPESGEEAVILLEDLERELDEPQHEMVAHRHRQEV
  LCKEMVPLAEQTPLTLQSQPKEPQLTCDSAQKCHSIGETDEVTKTEDRELVLRKDCPKIVEPHGKMFNEQTWEVS
  QQDPSHGEVGEHKDRIERQWGNLLGEGQHKCDECGKSFTQSSGLIRHQRIHTGERPYECNECGKAFSRSSGLFNH
  RGIHNIQKRYHCKECGKVFSQSAGLIQHQRIHKGEKPYQCSQCSKSYSRRSFLIEHQRSHTGERPHQCIECGKSF
  NRHCNLIRHQKIHTVAELV

• Structural information:
  • Protein Domains: (52..13-)
    (/note="SCAN-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00187"-)
  • Interpro: IPR003309  IPR038269  IPR036236  IPR013087  
  • Prosite: PS50804 PS00028 PS50157
  • CDD: cd07936
• Other Databases: GeneCards:  ZSCAN9  Malacards:  ZSCAN9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray