• Gene id: 7741

Gene Summary

• Gene Symbol: ZSCAN26   Gene   UCSC   Ensembl
• Aliases: SRE-ZBP, SREZBP, ZNF187
• Gene name: zinc finger and SCAN domain containing 26
• Alternate names: zinc finger and SCAN domain-containing protein 26, zinc finger protein 187,
• Gene location: 6p22.1 (28267009: 28278223)     Exons: 5     NC_000006.12
• OMIM: 616474

Protein Summary

• Protein general information: Q16670  
  • Name: Zinc finger and SCAN domain containing protein 26 (Protein SRE ZBP) (Zinc finger protein 187)
  • Length: 478  
  • Mass: 55254
• Sequence:

  MATALVSAHSLAPLNLKKEGLRVVREDHYSTWEQGFKLQGNSKGLGQEPLCKQFRQLRYEETTGPREALSRLREL
  CQQWLQPETHTKEQILELLVLEQFLIILPKELQARVQEHHPESREDVVVVLEDLQLDLGETGQQDPDQPKKQKIL
  VEEMAPLKGVQEQQVRHECEVTKPEKEKGEETRIENGKLIVVTDSCGRVESSGKISEPMEAHNEGSNLERHQAKP
  KEKIEYKCSEREQRFIQHLDLIEHASTHTGKKLCESDVCQSSSLTGHKKVLSREKGHQCHECGKAFQRSSHLVRH
  QKIHLGEKPYQCNECGKVFSQNAGLLEHLRIHTGEKPYLCIHCGKNFRRSSHLNRHQRIHSQEEPCECKECGKTF
  SQALLLTHHQRIHSHSKSHQCNECGKAFSLTSDLIRHHRIHTGEKPFKCNICQKAFRLNSHLAQHVRIHNEEKPY
  QCSECGEAFRQRSGLFQHQRYHHKDKLA

• Structural information:
  • Protein Domains: (51..13-)
    (/note="SCAN-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00187"-)
  • Interpro: IPR003309  IPR038269  IPR036236  IPR013087  
  • Prosite: PS50804 PS00028 PS50157
  • CDD: cd07936
  • STRING: ENSP00000484931
• Other Databases: GeneCards:  ZSCAN26  Malacards:  ZSCAN26

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003700	DNA-binding transcription factor activity	NAS	molecular function
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process
GO:0005634	nucleus	NAS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881