• Gene id: 7727

Gene Summary

• Gene Symbol: ZNF174   Gene   UCSC   Ensembl
• Aliases: ZSCAN8
• Gene name: zinc finger protein 174
• Alternate names: zinc finger protein 174, AW-1, zinc finger and SCAN domain-containing protein 8,
• Gene location: 16p13.3 (3401189: 3409363)     Exons: 4     NC_000016.10
• Gene summary(Entrez): This gene encodes a protein with three Cys2-His2-type zinc fingers in the carboxy-terminus, a putative nuclear localization signal, and an amino-terminus SCAN box which forms homodimers. This protein is believed to function as a transcriptional repressor.
• OMIM: 603900

Protein Summary

• Protein general information: Q15697  
  • Name: Zinc finger protein 174 (AW 1) (Zinc finger and SCAN domain containing protein 8)
  • Length: 407  
  • Mass: 46,455
• Sequence:

  MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDPELCRQSFRRFCYQEVSGPQEALSQLRQLCRQWL
  QPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHRASKKPKQWVAVCMQGQKVLLEKTG
  SQLGEQELPDFQPQTPRRDLRESSPAEPSQAGAYDRLSPHHWEKSPLLQEPTPKLAGTEAPRMRSDNKENPQQEG
  AKGAKPCAVSAGRSKGNGLQNPEPRGANMSEPRLSRRQVSSPNAQKPFAHYQRHCRVEYISSPLKSHPLRELKKS
  KGGKRSLSNRLQHLGHQPTRSAKKPYKCDDCGKSFTWNSELKRHKRVHTGERPYTCGECGNCFGRQSTLKLHQRI
  HTGEKPYQCGQCGKSFRQSSNLHQHHRLHHGD

• Structural information:
  • Protein Domains: SCAN (59-124)
  • Interpro: IPR003309  IPR038269  IPR027778  IPR036236  IPR013087  
  • Prosite: PS50804 PS00028 PS50157
  • CDD: cd07936
  • PDB: 1Y7Q
  • PDBsum: 1Y7Q
  • STRING: ENSP00000268655
• Other Databases: GeneCards:  ZNF174  Malacards:  ZNF174

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0000981	RNA polymerase II transcription factor activity, sequence-specific DNA binding	IBA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IDA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005634	nucleus	NAS	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0000981	RNA polymerase II transcription factor activity, sequence-specific DNA binding	IBA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IEA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IDA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	NAS	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0000981	RNA polymerase II transcription factor activity, sequence-specific DNA binding	IBA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IDA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005634	nucleus	NAS	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process

Diseases

Associated diseases	References
Necrozoospermia	MIK: 18572863
Necrozoospermia	MIK: 18572863

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
18572863	Necrozoospermia			11 (10 healthy donors, 1 necrozoospermic patient)	Male infertility	Sperm protein (human accession No. 060904) zinc finger protein 174 (AW-1) F-actin capping protein alpha-3 subunit testis-specific inhibitor of apoptosis death domain receptor 3 soluble form (fragment) and peptide similar to the activator of CREM in t